Three-dimensional solution structure of the extracellular region of the complement regulatory protein, CD59, a new cell surface protein domain related to neurotoxins. Determined by solution NMR. Released 30 Apr 1994.
Explore 1ERG in 3D Show helices and sheets RCSB PDB PDBe
1ERG contains 1 α-helix and 7 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 3-4 | 2 | 1 |
| β-strand | 16-17 | 2 | 1 |
| β-strand | 25-28 | 4 | 2 |
| β-strand | 31 | 1 | 3 |
| β-strand | 34 | 1 | 3 |
| β-strand | 37-40 | 4 | 2 |
| α-helix | 42-44 | 3 | |
| β-strand | 62-64 | 3 | 2 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| CD59 | A | protein | 70 | Homo sapiens | P13987 (AlphaFold model) |
>1ERG_1 CD59 (chains A) LQCYNCPNPTADCKTAVNCSSDFDACLITKAGLQVYNKCWKFEHCNFNDVTTRLRENELT YYCCKKDLCN
Three-dimensional solution structure of the extracellular region of the complement regulatory protein CD59, a new cell-surface protein domain related to snake venom neurotoxins. Kieffer, B., Driscoll, P.C., Campbell, I.D. et al. Biochemistry (1994) 33:4471-4482. DOI 10.1021/bi00181a006 · PubMed
Other PDB entries of the same protein (UniProt P13987 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1ERG directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.