Structure of the cytoplasmic beta subunit-T1 assembly of voltage-dependent K channels. Determined by X-ray diffraction at 2.1 Å resolution. Released 19 Jul 2000.
Explore 1EXB in 3D Show helices and sheets RCSB PDB PDBe
1EXB contains 27 α-helices and 18 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 39-41 | 3 | 1 |
| β-strand | 48-50 | 3 | 1 |
| β-strand | 52-55 | 4 | 2 |
| α-helix | 59-63 | 5 | |
| α-helix | 66-78 | 13 | |
| β-strand | 83-87 | 5 | 2 |
| α-helix | 90-93 | 4 | |
| α-helix | 94-106 | 13 | |
| α-helix | 110-112 | 3 | |
| β-strand | 114-119 | 6 | 2 |
| β-strand | 121 | 1 | 3 |
| α-helix | 126-128 | 3 | |
| β-strand | 129 | 1 | 3 |
| α-helix | 133-147 | 15 | |
| β-strand | 152-157 | 6 | 2 |
| α-helix | 166-178 | 13 | |
| β-strand | 182-188 | 7 | 2 |
| α-helix | 192-205 | 14 | |
| β-strand | 212-216 | 5 | 2 |
| β-strand | 218 | 1 | 4 |
| β-strand | 221 | 1 | 4 |
| α-helix | 223 | 1 | |
| α-helix | 224-228 | 5 | |
| α-helix | 229-236 | 8 | |
| β-strand | 239-243 | 5 | 2 |
| α-helix | 247-252 | 6 | |
| α-helix | 264-266 | 3 | |
| α-helix | 271-278 | 8 | |
| α-helix | 280-299 | 20 | |
| α-helix | 303-312 | 10 | |
| β-strand | 317-322 | 6 | 2 |
| α-helix | 327-334 | 8 | |
| α-helix | 336-339 | 4 | |
| α-helix | 340-342 | 3 | |
| α-helix | 345-355 | 11 | |
| α-helix | 358-360 | 3 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 38-43 | 6 | 5 |
| β-strand | 46-51 | 6 | 5 |
| α-helix | 52-56 | 5 | |
| α-helix | 66-69 | 4 | |
| α-helix | 70-72 | 3 | |
| β-strand | 73-74 | 2 | 5 |
| β-strand | 79-82 | 4 | 5 |
| α-helix | 86-97 | 12 | |
| α-helix | 110-119 | 10 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Kv BETA2 protein | A | protein | 332 | Rattus norvegicus | P62483 (AlphaFold model) |
| Potassium channel KV1.1 | E | protein | 103 | Rattus norvegicus | P10499 (AlphaFold model) |
>1EXB_1 KV BETA2 PROTEIN (chains A) LQFYRNLGKSGLRVSCLGLGTWVTFGGQITDEMAEHLMTLAYDNGINLFDTAEVYAAGKA EVVLGNIIKKKGWRRSSLVITTKIFWGGKAETERGLSRKHIIEGLKASLERLQLEYVDVV FANRPDPNTPMEETVRAMTHVINQGMAMYWGTSRWSSMEIMEAYSVARQFNLIPPICEQA EYHMFQREKVEVQLPELFHKIGVGAMTWSPLACGIVSGKYDSGIPPYSRASLKGYQWLKD KILSEEGRRQQAKLKELQAIAERLGCTLPQLAIAWCLRNEGVSSVLLGASNAEQLMENIG AIQVLPKLSSSIVHEIDSILGNKPYSKKDYRS
>1EXB_2 POTASSIUM CHANNEL KV1.1 (chains E) QADHDDHECCERVVINISGLRFETQLKTLAQFPNTLLGNPKKRMRYFDPLRNEYFFDRNR PSFDAILYYYQSGGRLRRPVNVPLDMFSEEIKFYELGEEAMEK
| ID | Name | Formula | Copies |
|---|---|---|---|
| NDP | NADPH dihydro-nicotinamide-adenine-dinucleotide phosphate | C21 H30 N7 O17 P3 | 1 |
Structure of the cytoplasmic beta subunit-T1 assembly of voltage-dependent K+ channels. Gulbis, J.M., Zhou, M., Mann, S. et al. Science (2000) 289:123-127. DOI 10.1126/science.289.5476.123 · PubMed
Other PDB entries of the same protein (UniProt P62483 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1EXB directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.