Voltage-dependent K+ channel beta subunit (W121A) in complex with cortisone. Determined by X-ray diffraction at 2.0 Å resolution. Released 23 Sept 2008.
Explore 3EB3 in 3D Show helices and sheets RCSB PDB PDBe
3EB3 contains 22 α-helices and 14 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 39-41 | 3 | 1 |
| β-strand | 48-50 | 3 | 1 |
| β-strand | 52-55 | 4 | 2 |
| α-helix | 59-63 | 5 | |
| α-helix | 66-78 | 13 | |
| β-strand | 83-85 | 3 | 2 |
| α-helix | 90-93 | 4 | |
| α-helix | 94-106 | 13 | |
| α-helix | 110-112 | 3 | |
| β-strand | 114-119 | 6 | 2 |
| β-strand | 121 | 1 | 3 |
| α-helix | 126-128 | 3 | |
| β-strand | 129 | 1 | 3 |
| α-helix | 133-147 | 15 | |
| β-strand | 152-157 | 6 | 2 |
| α-helix | 166-178 | 13 | |
| β-strand | 182-188 | 7 | 2 |
| α-helix | 192-204 | 13 | |
| α-helix | 208-210 | 3 | |
| β-strand | 212-216 | 5 | 2 |
| β-strand | 218 | 1 | 4 |
| β-strand | 221 | 1 | 4 |
| α-helix | 223 | 1 | |
| α-helix | 224-228 | 5 | |
| α-helix | 229-236 | 8 | |
| β-strand | 239-243 | 5 | 2 |
| α-helix | 247-252 | 6 | |
| α-helix | 264-266 | 3 | |
| α-helix | 271-278 | 8 | |
| α-helix | 280-299 | 20 | |
| α-helix | 303-312 | 10 | |
| β-strand | 317-322 | 6 | 2 |
| α-helix | 327-334 | 8 | |
| α-helix | 335-338 | 4 | |
| α-helix | 340-342 | 3 | |
| α-helix | 345-355 | 11 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Voltage-gated potassium channel subunit beta-2 | A | protein | 327 | Rattus norvegicus | P62483 (AlphaFold model) |
>3EB3_1 Voltage-gated potassium channel subunit beta-2 (chains A) MLQFYRNLGKSGLRVSCLGLGTWVTFGGQITDEMAEHLMTLAYDNGINLFDTAEVYAAGK AEVVLGNIIKKKGWRRSSLVITTKIFAGGKAETERGLSRKHIIEGLKASLERLQLEYVDV VFANRPDPNTPMEETVRAMTHVINQGMAMYWGTSRWSSMEIMEAYSVARQFNLIPPICEQ AEYHMFQREKVEVQLPELFHKIGVGAMTWSPLACGIVSGKYDSGIPPYSRASLKGYQWLK DKILSEEGRRQQAKLKELQAIAERLGCTLPQLAIAWCLRNEGVSSVLLGASNAEQLMENI GAIQVLPKLSSSIVHEIDSILGNKPYS
| ID | Name | Formula | Copies |
|---|---|---|---|
| PDN | 17,21-dihydroxypregna-1,4-diene-3,11,20-trione | C21 H26 O5 | 1 |
| NDP | NADPH dihydro-nicotinamide-adenine-dinucleotide phosphate | C21 H30 N7 O17 P3 | 1 |
Cortisone dissociates the Shaker family K+ channels from their beta subunits. Pan, Y., Weng, J., Kabaleeswaran, V. et al. Nat Chem Biol (2008) 4:708-714. DOI 10.1038/nchembio.114 · PubMed
Other PDB entries of the same protein (UniProt P62483 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 3EB3 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.