1FCG: Ectodomain of human fc gamma receptor, fcgriia

Ectodomain of human fc gamma receptor, fcgriia. Determined by X-ray diffraction at 2.0 Å resolution. Released 12 Apr 2000.

Method: X-ray diffraction
Resolution: 2.0 Å
Organism: Homo sapiens
Chains: 1
Atoms: 1,483
Mol. weight: 19.56 kDa
Released: 12 Apr 2000

Explore 1FCG in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1FCG contains 8 α-helices and 21 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 21 β-strands

Element	Residues	Length	Sheet
α-helix	5-6	2
β-strand	7	1	1
α-helix	8	1
β-strand	9-13	5	2
β-strand	18-20	3	3
β-strand	24-30	7	2
β-strand	40-44	5	4
β-strand	47-49	3	4
β-strand	56-60	5	2
α-helix	63-65	3
β-strand	67-73	7	4
β-strand	77	1	1
α-helix	78-81	4
β-strand	82-84	3	4
β-strand	85-87	3	3
β-strand	91-94	4	5
β-strand	99-100	2	6
α-helix	104-105	2
β-strand	106-112	7	5
α-helix	113-115	3
β-strand	118-125	8	7
β-strand	128-133	6	7
β-strand	138-141	4	5
α-helix	146-148	3
β-strand	150-158	9	7
β-strand	161-164	4	7
α-helix	165-167	3
β-strand	168-170	3	7
β-strand	171-172	2	6

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Protein (fc receptor fc(gamma)riia)	A	protein	174	Homo sapiens	P12318 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1FCG_1 PROTEIN (FC RECEPTOR FC(GAMMA)RIIA) (chains A)
QAAAPPKAVLKLEPPWINVLQEDSVTLTCQGARSPESDSIQWFHNGNLIPTHTQPSYRFK
ANNNDSGEYTCQTGQTSLSDPVHLTVLFEWLVLQTPHLEFQEGETIMLRCHSWKDKPLVK
VTFFQNGKSQKFSHLDPTFSIPQANHSHSGDYHCTGNIGYTLFSSKPVTITVQV

Primary citation

Crystal structure of the human leukocyte Fc receptor, Fc gammaRIIa. Maxwell, K.F., Powell, M.S., Hulett, M.D. et al. Nat Struct Biol (1999) 6:437-442. DOI 10.1038/8241 · PubMed

Other PDB entries of the same protein (UniProt P12318 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3RY4 1.5 Å, 1.5 Angstrom resolution structure of glycosylated fcgammariia (low-responder polymorphism)
8CHA 1.81 Å, Fc gamma RIIa 27W/131H variant ectodomain
9N5P 2.01 Å, Crystal structure of human IGG2 fc fragment-fc-gamma receptor iia complex H131 variant
3RY5 2.3 Å, Three-dimensional structure of glycosylated fcgammariia (high-responder polymorphism)
9MCX 2.38 Å, Crystal structure of human IgG1 fc fragment-fc-gamma receptor iia complex H131 variant
3D5O 2.8 Å, Structural recognition and functional activation of FcrR by innate pentraxins
1H9V 3.0 Å, Human Fc-gamma-Receptor IIa (FcgRIIa), monoclinic
10FJ 3.5 Å, FcgRIIa in complex with IV.3 Fab
3RY6 3.8 Å, Complex of fcgammariia (CD32) and the FC of human IGG1

Browse structure collections

About this viewer

MolViewer shows 1FCG directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.