1FLI: DNA-binding domain of fli-1
DNA-binding domain of fli-1. Determined by solution NMR. Released 15 Sept 1995.
- Method
- Solution NMR
- Organism
- Homo sapiens
- Chains
- 1
- Atoms
- 807
- Mol. weight
- 11.44 kDa
- Released
- 15 Sept 1995
Explore 1FLI in 3D
Show helices and sheets
RCSB PDB
PDBe
Secondary structure: helices and β-sheets
1FLI contains 4 α-helices and 4 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
Chain A: 4 helices, 4 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 284-292 | 9 | |
| β-strand | 300-301 | 2 | 1 |
| β-strand | 310-311 | 2 | 1 |
| α-helix | 314-324 | 11 | |
| α-helix | 333-344 | 12 | |
| β-strand | 351 | 1 | 2 |
| α-helix | 352-354 | 3 | |
| β-strand | 357 | 1 | 2 |
Molecules and chains
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|
| FLI-1 | A | protein | 98 | Homo sapiens | Q01543 (AlphaFold model) |
Sequence of entity 1 (A), FASTA
>1FLI_1 FLI-1 (chains A)
PGSGQIQLWQFLLELLSDSANASCITWEGTNGEFKMTDPDEVARRWGERKSKPNMNYDKL
SRALRYYYDKNIMTKVHGKRYAYKFDFHGIAQALQPHP
Primary citation
Solution structure of the ets domain of Fli-1 when bound to DNA. Liang, H., Mao, X., Olejniczak, E.T. et al. Nat Struct Biol (1994) 1:871-875. DOI 10.1038/nsb1294-871 · PubMed
Other PDB entries of the same protein (UniProt Q01543 (AlphaFold model), which also has an AlphaFold model), best resolution first:
- 9CP6 1.66 Å, Crystal structure of the DNA binding domain of FLI1 (residues 259-371)
- 9MX9 2.55 Å, Crystal structure of the DNA binding domain of FLI1 (F362A) in complex with a DNA…
- 9MXA 2.59 Å, Crystal structure of the DNA binding domain of FLI1 (wild-type) in complex with a DNA…
- 5E8G 2.7 Å, Crystal structure of the DNA binding domain of human transcription factor FLI1
- 5JVT 3.1 Å, Crystal structure of the DNA binding domain of transcription factor FLI1 in complex with…
- 9MX8 3.15 Å, Crystal structure of the DNA binding domain of FLI1 in complex with a DNA containing…
- 9MWY 3.28 Å, Crystal structure of the DNA binding domain of FLI1 in complex with a DNA containing…
- 5E8I 3.45 Å, Crystal structure of the DNA binding domain of human transcription factor FLI1 in…
- 6VG2 3.9 Å, Crystal structure of the DNA binding domain of human transcription factor FLI1 in…
- 6VGD 4.2 Å, Crystal structure of the DNA binding domain (DBD) of human FLI1 and the complex of the…
- 6VG8 4.31 Å, Crystal structure of the DNA binding domains of human FLI1 and Runx2 in complex with…
- 1X66 Solution structure of the SAM_PNT-domain of the human friend LEUKEMIAINTEGRATION 1…
Browse structure collections
About this viewer
MolViewer shows 1FLI directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.