1FNF: Fibronectin

Fragment of human fibronectin encompassing type-III repeats 7 through 10. Determined by X-ray diffraction at 2.0 Å resolution. Released 29 Jan 1996.

Method: X-ray diffraction
Resolution: 2.0 Å
Organism: Homo sapiens
Chains: 1
Atoms: 3,079
Mol. weight: 39.98 kDa
Released: 29 Jan 1996

Explore 1FNF in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1FNF contains 11 α-helices and 32 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 11 helices, 32 β-strands

Element	Residues	Length	Sheet
α-helix	1144-1146	3
β-strand	1147-1153	7	1
β-strand	1160-1165	6	1
α-helix	1166-1167	2
β-strand	1174-1181	8	2
β-strand	1190-1194	5	2
β-strand	1200-1202	3	1
β-strand	1212-1220	9	2
β-strand	1223-1224	2	2
β-strand	1228-1232	5	2
α-helix	1234-1239	6
β-strand	1240-1245	6	3
β-strand	1252-1257	6	3
α-helix	1258-1259	2
β-strand	1266-1273	8	4
β-strand	1281-1285	5	4
β-strand	1291-1294	4	3
α-helix	1297-1298	2
β-strand	1302-1311	10	4
β-strand	1314-1315	2	4
β-strand	1319-1324	6	4
α-helix	1327-1330	4
β-strand	1331-1336	6	5
β-strand	1342-1348	7	5
β-strand	1356-1362	7	6
α-helix	1369-1370	2
β-strand	1371-1376	6	6
β-strand	1381-1385	5	5
α-helix	1387-1388	2
β-strand	1392-1401	10	6
β-strand	1404-1405	2	6
α-helix	1406-1408	3
β-strand	1409-1414	6	6
α-helix	1415-1417	3
β-strand	1421-1429	9	7
β-strand	1432-1438	7	7
β-strand	1446-1453	8	8
α-helix	1459-1460	2
β-strand	1461-1466	6	8
β-strand	1471-1474	4	7
β-strand	1483-1490	8	8
β-strand	1499	1	8
β-strand	1503-1507	5	8

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Fibronectin	A	protein	368	Homo sapiens	P02751 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1FNF_1 FIBRONECTIN (chains A)
PLSPPTNLHLEANPDTGVLTVSWERSTTPDITGYRITTTPTNGQQGNSLEEVVHADQSSC
TFDNLSPGLEYNVSVYTVKDDKESVPISDTIIPAVPPPTDLRFTNIGPDTMRVTWAPPPS
IDLTNFLVRYSPVKNEEDVAELSISPSDNAVVLTNLLPGTEYVVSVSSVYEQHESTPLRG
RQKTGLDSPTGIDFSDITANSFTVHWIAPRATITGYRIRHHPEHFSGRPREDRVPHSRNS
ITLTNLTPGTEYVVSIVALNGREESPLLIGQQSTVSDVPRDLEVVAATPTSLLISWDAPA
VTVRYYRITYGETGGNSPVQEFTVPGSKSTATISGLKPGVDYTITVYAVTGRGDSPASSK
PISINYRT

Primary citation

2.0 A crystal structure of a four-domain segment of human fibronectin encompassing the RGD loop and synergy region. Leahy, D.J., Aukhil, I., Erickson, H.P. Cell (1996) 84:155-164. DOI 10.1016/S0092-8674(00)81002-8 · PubMed

Other PDB entries of the same protein (UniProt P02751 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2CG7 1.2 Å, Second and third fibronectin type I module pair (crystal form II).
4LXO 1.42 Å, Crystal structure of 9,10Fn3-elegantin chimera
5DC4 1.48 Å, Crystal structure of monobody AS25/ABL1 SH2 domain complex, crystal a
2CG6 1.55 Å, Second and third fibronectin type I module pair (crystal form I).
5DC9 1.56 Å, Crystal structure of monobody AS25/ABL1 SH2 domain complex, crystal B
5N48 1.6 Å, Structure of Anticalin N9B in complex with extra-domain B of human oncofetal fibronectin
3CAL 1.7 Å, Crystal structure of the second and third fibronectin F1 modules in complex with a…
3ZRZ 1.7 Å, Crystal structure of the second and third fibronectin F1 modules in complex with a…
6MFA 1.75 Å, Fragment of human fibronectin containing the 4th-7th type III domains
1FNA 1.8 Å, Crystal structure of the tenth type III cell adhesion module of human fibronectin
2RKY 1.8 Å, Crystal structure of the fourth and fifth fibronectin F1 modules in complex with a…
4PZ5 1.96 Å, Crystal structure of the second and third fibronectin F1 modules in complex with a…

Browse structure collections

About this viewer

MolViewer shows 1FNF directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.