1G73: Smac

Crystal structure of smac bound to xiap-BIR3 domain. Determined by X-ray diffraction at 2.0 Å resolution. Released 10 Jan 2001.

Method: X-ray diffraction
Resolution: 2.0 Å
Organism: Homo sapiens
Chains: 4
Atoms: 4,010
Mol. weight: 64.21 kDa
Ligands: ZN
Released: 10 Jan 2001

Explore 1G73 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1G73 contains 19 α-helices and 8 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	2-3	2	1
α-helix	4-5	2
α-helix	14-64	51
α-helix	72-118	47
α-helix	122-156	35

Chain B: 3 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	2-3	2	2
α-helix	14-64	51
α-helix	72-118	47
α-helix	122-155	34

Chain C: 5 helices, 3 β-strands

Element	Residues	Length	Sheet
α-helix	260-262	3
α-helix	265-270	6
α-helix	281-286	6
β-strand	289-291	3	2
β-strand	298-300	3	2
β-strand	306-308	3	2
α-helix	316-323	8
α-helix	328-342	15

Chain D: 7 helices, 3 β-strands

Element	Residues	Length	Sheet
α-helix	260-262	3
α-helix	265-270	6
α-helix	281-286	6
β-strand	289-291	3	1
β-strand	298-300	3	1
β-strand	306-308	3	1
α-helix	316-323	8
α-helix	328-343	16
α-helix	346-353	8
α-helix	354-356	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Second mitochondria-derived activator of caspases	A, B	protein	162	Homo sapiens	Q9NR28 (AlphaFold model)
Inhibitors of apoptosis-like protein ilp	C, D	protein	121	Homo sapiens	P98170 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>1G73_1 SECOND MITOCHONDRIA-DERIVED ACTIVATOR OF CASPASES (chains A, B)
AVPIAQKSEPHSLSSEALMRRAVSLVTDSTSTDLSQTTYALIEAITEYTKAVYTLTSLYR
QYTSLLGKMNSEEEDEVWQVIIGARAEMTSKHQEYLKLETTWMTAVGLSEMAAEAAYQTG
ADQASITARNHIQLVKLQVEEVHQLSRKAETKLAEAQIEELR

Sequence of entity 2 (C, D), FASTA

>1G73_2 INHIBITORS OF APOPTOSIS-LIKE PROTEIN ILP (chains C, D)
RSESDAVSSDRNFPNSTNLPRNPSMADYEARIFTFGTWIYSVNKEQLARAGFYALGEGDK
VKCFHCGGGLTDWKPSEDPWEQHAKWYPGCKYLLEQKGQEYINNIHLTHSLEECLVRTTE
K

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	2

Primary citation

Structural basis of IAP recognition by Smac/DIABLO. Wu, G., Chai, J., Suber, T.L. et al. Nature (2000) 408:1008-1012. DOI 10.1038/35050012 · PubMed

Other PDB entries of the same protein (UniProt Q9NR28 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1TW6 1.71 Å, Structure of an ML-IAP/XIAP chimera bound to a 9mer peptide derived from Smac
4TX5 1.8 Å, Crystal structure of Smac-DIABLO (in space group P65)
1FEW 2.2 Å, Crystal structure of smac/diablo
1XB0 2.2 Å, Structure of the BIR domain of IAP-like protein 2
1OXQ 2.3 Å, Structure and Function Analysis of Peptide Antagonists of Melanoma Inhibitor of…
3D9U 2.3 Å, The BIR3 domain of cIAP1 in complex with the N terminal peptide from SMAC/DIABLO (AVPIAQ).
3UIH 2.4 Å, crystal structure of human Survivin in complex with Smac/DIABLO(1-15) peptide
1XB1 2.7 Å, The Structure of the BIR domain of IAP-like protein 2
3UIJ 2.71 Å, Crystal structure of human Survivin K62Y/H80W mutant in complex with Smac/DIABLO(1-15)…
6JX6 2.81 Å, Tetrameric form of Smac
8ATO 3.0 Å, Structure of the giant inhibitor of apoptosis, BIRC6 bound to the regulator SMAC
8E2I 3.04 Å, Cryo-EM structure of BIRC6/Smac

Browse structure collections

About this viewer

MolViewer shows 1G73 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.