1GVJ: Ets-1 DNA binding and autoinhibitory domains

Ets-1 DNA binding and autoinhibitory domains. Determined by X-ray diffraction at 1.53 Å resolution. Released 6 Feb 2004.

Method: X-ray diffraction
Resolution: 1.53 Å
Organism: HOMO SAPIENS
Chains: 2
Atoms: 2,654
Mol. weight: 34.01 kDa
Released: 6 Feb 2004

Explore 1GVJ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1GVJ contains 18 α-helices and 8 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 9 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	304-313	10
α-helix	323-330	8
α-helix	337-345	9
α-helix	348-350	3
β-strand	355-356	2	1
β-strand	362-364	3	1
α-helix	368-379	12
α-helix	386-398	13
β-strand	402-404	3	1
α-helix	405	1
β-strand	411-414	4	1
α-helix	418-422	5
α-helix	426-432	7

Chain B: 9 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	304-312	9
α-helix	323-330	8
α-helix	337-345	9
α-helix	348-350	3
β-strand	354-356	3	2
β-strand	362-365	4	2
α-helix	368-379	12
α-helix	386-398	13
β-strand	402-404	3	2
α-helix	405	1
β-strand	411-414	4	2
α-helix	418-422	5
α-helix	426-432	7

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
C-ets-1 protein	A, B	protein	146	HOMO SAPIENS	P14921 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>1GVJ_1 C-ETS-1 PROTEIN (chains A, B)
MNHKPKGTFKDYVRDRADLNKDKPVIPAAALAGYTGSGPIQLWQFLLELLTDKSCQSFIS
WTGDGWEFKLSDPDEVARRWGKRKNKPKMNYEKLSRGLRYYYDKNIIHKTAGKRYVYRFV
CDLQSLLGYTPEELHAMLDVKPDADE

Primary citation

Crystal Structure of C-Ets-1 DNA-Binding and Autoinhibitory Domains. Tahirov, T.H., Inoue-Bungo, T., Ogata, K. To be published.

Other PDB entries of the same protein (UniProt P14921 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4LG0 2.19 Å, Structure of a ternary FOXO1-ETS1 DNA complex
4L18 2.3 Å, Crystal structure of Runx1 and Ets1 bound to TCR alpha promoter (crystal form 3)
3WTS 2.35 Å, Crystal structure of the complex comprised of ETS1, RUNX1, CBFBETA, and the tcralpha…
3WTT 2.35 Å, Crystal structure of the complex comprised of phosphorylated ETS1, RUNX1, CBFBETA, and…
3WU1 2.4 Å, Crystal structure of the ETS1-RUNX1-DNA ternary complex
4L0Y 2.5 Å, Crystal structure of Runx1 and Ets1 bound to TCR alpha promoter (crystal form 1)
2NNY 2.58 Å, Crystal structure of the Ets1 dimer DNA complex.
3WU0 2.6 Å, Crystal structure of phosphorylated ETS-1 DNA binding and autoinhibitory domains (276-441)
3WTZ 2.61 Å, Crystal structure of ETS-1 DNA binding and autoinhibitory domains (276-441)
3WTU 2.7 Å, Crystal structure of the complex comprised of ETS1 (V170A), RUNX1, CBFBETA, and the…
3WTV 2.7 Å, Crystal structure of the complex comprised of ETS1(V170G), RUNX1, CBFBETA, and the…
3WTY 2.7 Å, Crystal structure of the complex comprised of ETS1(G333P), RUNX1, CBFBETA, and the…

Browse structure collections

About this viewer

MolViewer shows 1GVJ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.