2NNY: Ets1 dimer DNA complex

Crystal structure of the Ets1 dimer DNA complex. Determined by X-ray diffraction at 2.58 Å resolution. Released 4 Mar 2008.

Method: X-ray diffraction
Resolution: 2.58 Å
Organism: Homo sapiens
Chains: 4
Atoms: 3,060
Mol. weight: 53.88 kDa
Released: 4 Mar 2008

Explore 2NNY in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2NNY contains 17 α-helices and 8 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	323-330	8
α-helix	337-345	9
α-helix	349-352	4
β-strand	355-356	2	1
β-strand	362-364	3	1
α-helix	368-379	12
α-helix	386-394	9
α-helix	395-397	3
β-strand	402-404	3	1
β-strand	411-414	4	1
α-helix	418-422	5
α-helix	426-432	7

Chain B: 9 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	323-330	8
α-helix	335-336	2
α-helix	337-345	9
α-helix	348-350	3
β-strand	354-356	3	2
β-strand	362-365	4	2
α-helix	368-379	12
α-helix	386-394	9
β-strand	402-404	3	2
α-helix	405	1
β-strand	411-414	4	2
α-helix	419-422	4
α-helix	426-432	7

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
5'-d(tapgpapcpapgpgpapapgpcpapcptptpcpcptpgpgpap*g)-3'	C	DNA	23
5'-d(acptpcpcpapgpgpapapgptpgpcptptpcpcptpgptpcp*t)-3'	D	DNA	23
C-ets-1 protein	A, B	protein	171	Homo sapiens	P14921 (AlphaFold model)

Sequence of entity 1 (C), FASTA

>2NNY_1 5'-D(*T*AP*GP*AP*CP*AP*GP*GP*AP*AP*GP*CP*AP*CP*TP*TP*CP*CP*TP*GP*GP*AP*G)-3' (chains C)
TAGACAGGAAGCACTTCCTGGAG

Sequence of entity 2 (D), FASTA

>2NNY_2 5'-D(*A*CP*TP*CP*CP*AP*GP*GP*AP*AP*GP*TP*GP*CP*TP*TP*CP*CP*TP*GP*TP*CP*T)-3' (chains D)
ACTCCAGGAAGTGCTTCCTGTCT

Sequence of entity 3 (A, B), FASTA

>2NNY_3 C-ets-1 protein (chains A, B)
MKHHHHHPMVPSYDSFDSEDYPAALPNHKPKGTFKDYVRDRADLNKDKPVIPAAALAGYT
GSGPIQLWQFLLELLTDKSSQSFISWTGDGWEFKLSDPDEVARRWGKRKNKPKMNYEKLS
RGLRYYYDKNIIHKTAGKRYVYRFVSDLQSLLGYTPEELHAMLDVKPDADE

Primary citation

Regulation of the transcription factor Ets-1 by DNA-mediated homo-dimerization. Lamber, E.P., Vanhille, L., Textor, L.C. et al. EMBO J (2008) 27:2006-2017. DOI 10.1038/emboj.2008.117 · PubMed

Other PDB entries of the same protein (UniProt P14921 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1GVJ 1.53 Å, Ets-1 DNA binding and autoinhibitory domains
4LG0 2.19 Å, Structure of a ternary FOXO1-ETS1 DNA complex
4L18 2.3 Å, Crystal structure of Runx1 and Ets1 bound to TCR alpha promoter (crystal form 3)
3WTS 2.35 Å, Crystal structure of the complex comprised of ETS1, RUNX1, CBFBETA, and the tcralpha…
3WTT 2.35 Å, Crystal structure of the complex comprised of phosphorylated ETS1, RUNX1, CBFBETA, and…
3WU1 2.4 Å, Crystal structure of the ETS1-RUNX1-DNA ternary complex
4L0Y 2.5 Å, Crystal structure of Runx1 and Ets1 bound to TCR alpha promoter (crystal form 1)
3WU0 2.6 Å, Crystal structure of phosphorylated ETS-1 DNA binding and autoinhibitory domains (276-441)
3WTZ 2.61 Å, Crystal structure of ETS-1 DNA binding and autoinhibitory domains (276-441)
3WTU 2.7 Å, Crystal structure of the complex comprised of ETS1 (V170A), RUNX1, CBFBETA, and the…
3WTV 2.7 Å, Crystal structure of the complex comprised of ETS1(V170G), RUNX1, CBFBETA, and the…
3WTY 2.7 Å, Crystal structure of the complex comprised of ETS1(G333P), RUNX1, CBFBETA, and the…

Browse structure collections

About this viewer

MolViewer shows 2NNY directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.