1GYF: Gyf domain from human CD2BP2 protein

Gyf domain from human CD2BP2 protein. Determined by solution NMR. Released 5 Jan 2000.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 518
Mol. weight: 7.32 kDa
Released: 5 Jan 2000

Explore 1GYF in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1GYF contains 2 α-helices and 6 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	27	1	1
β-strand	28-31	4	2
β-strand	40-41	2	2
β-strand	45	1	1
α-helix	46-55	10
β-strand	63-66	4	2
β-strand	75-76	2	2
α-helix	77-79	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Protein (cytoplasmic domain binding protein (CD2BP2))	A	protein	62	Homo sapiens	O95400 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1GYF_1 PROTEIN (CYTOPLASMIC DOMAIN BINDING PROTEIN (CD2BP2)) (chains A)
DVMWEYKWENTGDAELYGPFTSAQMQTWVSEGYFPDGVYCRKLDPPGGQFYNSKRIDFDL
YT

Primary citation

The GYF domain is a novel structural fold that is involved in lymphoid signaling through proline-rich sequences. Freund, C., Dotsch, V., Nishizawa, K. et al. Nat Struct Biol (1999) 6:656-660. DOI 10.1038/10712 · PubMed

Other PDB entries of the same protein (UniProt O95400 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1SYX 2.35 Å, The crystal structure of a binary U5 snRNP complex
4BWS 2.5 Å, Crystal structure of the heterotrimer of PQBP1, U5-15kD and U5-52kD.
8Q91 3.1 Å, Structure of the human 20S U5 snRNP core
8Q7Q 3.2 Å, Structure of the recycling U5 snRNP bound to chaperones CD2BP2 and TSSC4 (State 2)
8RC0 3.2 Å, Structure of the human 20S U5 snRNP
8Q7V 3.8 Å, Structure of the recycling U5 snRNP bound to chaperones CD2BP2 and TSSC4 (State 1)
8Q7W 3.9 Å, Structure of the recycling U5 snRNP bound to chaperone CD2BP2 (State 3)
8Q7X 4.6 Å, Structure of the recycling U5 snRNP bound to chaperone CD2BP2 (State 4)
1L2Z CD2BP2-GYF domain in complex with proline-rich CD2 tail segment peptide

Browse structure collections

About this viewer

MolViewer shows 1GYF directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.