1H1J: THO1 protein

The SAP domain is a DNA-Binding Domain Capable of Binding S/MAR DNA. Determined by solution NMR. Released 8 Aug 2002.

Method: Solution NMR
Organism: SACCHAROMYCES CEREVISIAE
Chains: 1
Atoms: 337
Mol. weight: 5.58 kDa
Released: 8 Aug 2002

Explore 1H1J in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1H1J contains 3 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain S: 3 helices, 0 β-strands

Element	Residues	Length
α-helix	5-7	3
α-helix	10-19	10
α-helix	28-41	14

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
THO1 protein	S	protein	51	SACCHAROMYCES CEREVISIAE	P40040 (AlphaFold model)

Sequence of entity 1 (S), FASTA

>1H1J_1 THO1 PROTEIN (chains S)
GSADYSSLTVVQLKDLLTKRNLSVGGLKNELVQRLIKDDEESKGESEVSPQ

Primary citation

The Sap Domain is a DNA-Binding Domain Capable of Binding S/Mar DNA. Jacobsen, J.O.B., Freund, S.M.V., Bycroft, M. To be published.

Other PDB entries of the same protein (UniProt P40040 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8ENK 2.5 Å, Crystal structure of UAP56 in complex with Tho1, the yeast homolog of human SARNP
2WQG SAP domain from Tho1: L31W (fluorophore) mutant
4UZW High-resolution NMR structures of the domains of Saccharomyces cerevisiae Tho1
4UZX High-resolution NMR structures of the domains of Saccharomyces cerevisiae Tho1

Browse structure collections

About this viewer

MolViewer shows 1H1J directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.