High-resolution NMR structures of the domains of Saccharomyces cerevisiae Tho1. Determined by solution NMR. Released 17 Dec 2014.
Explore 4UZX in 3D Show helices and sheets RCSB PDB PDBe
4UZX contains 3 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 122-143 | 22 | |
| α-helix | 147-162 | 16 | |
| α-helix | 170-175 | 6 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Protein THO1 | A | protein | 67 | SACCHAROMYCES CEREVISIAE | P40040 (AlphaFold model) |
>4UZX_1 PROTEIN THO1 (chains A) GSALSPEEIKAKALDLLNKKLHRANKFGQDQADIDSLQRQINRVEKFGVDLNSKLAEELG LVSRKNE
High-Resolution NMR Structures of the Domains of Saccharomyces Cerevisiae Tho1. Jacobsen, J.O.B., Allen, M.D., Freund, S.M.V. et al. Acta Crystallogr F Struct Biol Commun (2016) 72:500. DOI 10.1107/S2053230X16007597 · PubMed
Other PDB entries of the same protein (UniProt P40040 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 4UZX directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.