2WQG: SAP domain from Tho1: L31W (fluorophore) mutant

SAP domain from Tho1: L31W (fluorophore) mutant. Determined by solution NMR. Released 16 Feb 2010.

Method: Solution NMR
Organism: SACCHAROMYCES CEREVISIAE
Chains: 1
Atoms: 397
Mol. weight: 5.66 kDa
Released: 16 Feb 2010

Explore 2WQG in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2WQG contains 2 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 0 β-strands

Element	Residues	Length	Sheet
α-helix	10-20	11
α-helix	28-40	13

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Protein THO1	A	protein	51	SACCHAROMYCES CEREVISIAE	P40040 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2WQG_1 PROTEIN THO1 (chains A)
GSADYSSLTVVQLKDLLTKRNLSVGGLKNEWVQRLIKDDEESKGESEVSPQ

Primary citation

Engineering a Two-Helix Bundle Protein for Folding Studies. Dodson, C.A., Ferguson, N., Rutherford, T.J. et al. Protein Eng Des Sel (2010) 23:357. DOI 10.1093/PROTEIN/GZP080 · PubMed

Other PDB entries of the same protein (UniProt P40040 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8ENK 2.5 Å, Crystal structure of UAP56 in complex with Tho1, the yeast homolog of human SARNP
1H1J The SAP domain is a DNA-Binding Domain Capable of Binding S/MAR DNA
4UZW High-resolution NMR structures of the domains of Saccharomyces cerevisiae Tho1
4UZX High-resolution NMR structures of the domains of Saccharomyces cerevisiae Tho1

Browse structure collections

About this viewer

MolViewer shows 2WQG directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.