4UZW: Domains of Saccharomyces cerevisiae Tho1

High-resolution NMR structures of the domains of Saccharomyces cerevisiae Tho1. Determined by solution NMR. Released 17 Dec 2014.

Method: Solution NMR
Organism: SACCHAROMYCES CEREVISIAE
Chains: 1
Atoms: 387
Mol. weight: 5.53 kDa
Released: 17 Dec 2014

Explore 4UZW in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4UZW contains 3 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 0 β-strands

Element	Residues	Length
α-helix	3-6	4
α-helix	9-19	11
α-helix	27-42	16

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Protein THO1	A	protein	50	SACCHAROMYCES CEREVISIAE	P40040 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>4UZW_1 PROTEIN THO1 (chains A)
SADYSSLTVVQLKDLLTKRNLSVGGLKNELVQRLIKDDEESKGESEVSPQ

Primary citation

High-Resolution NMR Structures of the Domains of Saccharomyces Cerevisiae Tho1. Jacobsen, J.O.B., Allen, M.D., Freund, S.M.V. et al. Acta Crystallogr F Struct Biol Commun (2016) 72:500. DOI 10.1107/S2053230X16007597 · PubMed

Other PDB entries of the same protein (UniProt P40040 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8ENK 2.5 Å, Crystal structure of UAP56 in complex with Tho1, the yeast homolog of human SARNP
1H1J The SAP domain is a DNA-Binding Domain Capable of Binding S/MAR DNA
2WQG SAP domain from Tho1: L31W (fluorophore) mutant
4UZX High-resolution NMR structures of the domains of Saccharomyces cerevisiae Tho1

Browse structure collections

About this viewer

MolViewer shows 4UZW directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.