1H4R: Merlin

Crystal Structure of the FERM domain of Merlin, the Neurofibromatosis 2 Tumor Suppressor Protein. Determined by X-ray diffraction at 1.8 Å resolution. Released 16 Jan 2002.

Method: X-ray diffraction
Resolution: 1.8 Å
Organism: HOMO SAPIENS
Chains: 2
Atoms: 5,803
Mol. weight: 74.55 kDa
Released: 16 Jan 2002

Explore 1H4R in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1H4R contains 25 α-helices and 28 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 13 helices, 14 β-strands

Element	Residues	Length	Sheet
β-strand	21-27	7	1
β-strand	32-38	7	1
β-strand	42	1	2
α-helix	43-54	12
α-helix	59-61	3
β-strand	62-68	7	1
β-strand	71-74	4	1
β-strand	80	1	2
α-helix	81-83	3
β-strand	92-98	7	1
α-helix	105-108	4
α-helix	112-127	16
α-helix	135-150	16
α-helix	171-174	4
α-helix	181-193	13
α-helix	200-211	12
α-helix	219	1
β-strand	220-226	7	3
β-strand	231-236	6	3
β-strand	240-244	5	3
β-strand	254-257	4	3
α-helix	258-260	3
β-strand	261-267	7	3
β-strand	270-275	6	3
α-helix	281-282	2
β-strand	283-286	4	3
α-helix	290-310	21

Chain B: 12 helices, 14 β-strands

Element	Residues	Length	Sheet
β-strand	21-27	7	4
β-strand	32-38	7	4
β-strand	42	1	5
α-helix	43-54	12
α-helix	59-61	3
β-strand	62-68	7	4
β-strand	71-74	4	4
β-strand	80	1	5
α-helix	81-83	3
β-strand	92-98	7	4
α-helix	105-108	4
α-helix	112-127	16
α-helix	135-150	16
α-helix	171-176	6
α-helix	181-193	13
α-helix	200-211	12
β-strand	220-226	7	6
β-strand	231-236	6	6
β-strand	240-244	5	6
β-strand	254-257	4	6
α-helix	258-260	3
β-strand	261-267	7	6
β-strand	270-275	6	6
α-helix	281-282	2
β-strand	283-286	4	6
α-helix	290-311	22

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Merlin	A, B	protein	314	HOMO SAPIENS	P35240 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>1H4R_1 MERLIN (chains A, B)
GMAGAIASRMSFSSLKRKQPKTFTVRIVTMDAEMEFNCEMKWKGKDLFDLVCRTLGLRET
WFFGLQYTIKDTVAWLKMDKKVLDHDVSKEEPVTFHFLAKFYPENAEEELVQEITQHLFF
LQVKKQILDEKIYCPPEASVLLASYAVQAKYGDYDPSVHKRGFLAQEELLPKRVINLYQM
TPEMWEERITAWYAEHRGRARDEAEMEYLKIAQDLEMYGVNYFAIRNKKGTELLLGVDAL
GLHIYDPENRLTPKISFPWNEIRNISYSDKEFTIKPLDKKIDVFKFNSSKLRVNKLILQL
CIGNHDLFMRRRKA

Primary citation

The Structure of the Ferm Domain of Merlin, the Neurofibromatosis Type 2 Gene Product. Kang, B.S., Cooper, D.R., Devedjiev, Y. et al. Acta Crystallogr D Biol Crystallogr (2002) 58:381. DOI 10.1107/S0907444901021175 · PubMed

Other PDB entries of the same protein (UniProt P35240 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7LWH 1.61 Å, Human neurofibromin 2/merlin residues 1-339 in complex with LATS1
4ZRJ 2.3 Å, Structure of Merlin-FERM and CTD
6CDS 2.62 Å, Human neurofibromin 2/merlin/schwannomin residues 1-339 in complex with PIP2
3U8Z 2.64 Å, human merlin FERM domain
4ZRI 2.7 Å, Crystal structure of Merlin-FERM and Lats2

Browse structure collections

About this viewer

MolViewer shows 1H4R directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.