3U8Z: Human merlin FERM domain

human merlin FERM domain. Determined by X-ray diffraction at 2.64 Å resolution. Released 2 Nov 2011.

Method: X-ray diffraction
Resolution: 2.64 Å
Organism: Homo sapiens
Chains: 4
Atoms: 9,077
Mol. weight: 141.78 kDa
Released: 2 Nov 2011

Explore 3U8Z in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3U8Z contains 46 α-helices and 59 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 12 helices, 15 β-strands

Element	Residues	Length	Sheet
β-strand	21-27	7	1
β-strand	32-38	7	1
β-strand	42	1	2
α-helix	43-53	11
α-helix	59-61	3
β-strand	62-68	7	1
β-strand	71-74	4	1
β-strand	80	1	2
β-strand	92-98	7	1
α-helix	105-108	4
α-helix	112-127	16
α-helix	135-149	15
β-strand	179	1	3
α-helix	181-194	14
α-helix	198-200	3
α-helix	202-211	10
α-helix	219	1
β-strand	220-226	7	4
β-strand	231-236	6	4
β-strand	240-244	5	4
β-strand	254-257	4	4
α-helix	258-260	3
β-strand	261-267	7	4
β-strand	270-275	6	4
α-helix	281-282	2
β-strand	283-286	4	4
α-helix	290-309	20

Chain B: 12 helices, 15 β-strands

Element	Residues	Length	Sheet
β-strand	22-27	6	5
β-strand	32-37	6	5
β-strand	42	1	6
α-helix	43-53	11
α-helix	59-61	3
β-strand	62-68	7	5
β-strand	71-74	4	5
β-strand	80	1	6
β-strand	92-98	7	5
α-helix	105-108	4
α-helix	112-127	16
α-helix	135-149	15
β-strand	179	1	7
α-helix	181-194	14
α-helix	198-200	3
α-helix	202-211	10
α-helix	219	1
β-strand	220-226	7	8
β-strand	231-236	6	8
β-strand	240-244	5	8
β-strand	254-257	4	8
α-helix	258-260	3
β-strand	261-267	7	8
β-strand	270-275	6	8
α-helix	281-282	2
β-strand	283-286	4	8
α-helix	290-309	20

Chain C: 12 helices, 15 β-strands

Element	Residues	Length	Sheet
β-strand	22-27	6	1
β-strand	31-37	7	1
β-strand	42	1	9
α-helix	43-53	11
α-helix	59-61	3
β-strand	62-68	7	1
β-strand	71-74	4	1
β-strand	80	1	9
β-strand	92-98	7	1
α-helix	105-108	4
α-helix	112-127	16
α-helix	135-150	16
β-strand	179	1	4
α-helix	181-194	14
α-helix	198-200	3
α-helix	202-211	10
α-helix	219	1
β-strand	220-226	7	3
β-strand	231-236	6	3
β-strand	240-244	5	3
β-strand	254-257	4	3
α-helix	258-260	3
β-strand	261-267	7	3
β-strand	270-275	6	3
α-helix	281-282	2
β-strand	283-286	4	3
α-helix	290-310	21

Chain D: 10 helices, 14 β-strands

Element	Residues	Length	Sheet
β-strand	22-27	6	5
β-strand	32-37	6	5
β-strand	42	1	10
α-helix	43-53	11
α-helix	59-61	3
β-strand	62-68	7	5
β-strand	71-74	4	5
β-strand	80	1	10
β-strand	92-98	7	5
α-helix	105-108	4
α-helix	112-127	16
α-helix	135-149	15
α-helix	200-211	12
α-helix	219	1
β-strand	220-226	7	7
β-strand	231-236	6	7
β-strand	240-244	5	7
β-strand	254-257	4	7
α-helix	258-260	3
β-strand	261-267	7	7
β-strand	270-275	6	7
α-helix	281-282	2
β-strand	283-286	4	7
α-helix	290-309	20

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Merlin	A, B, C, D	protein	300	Homo sapiens	P35240 (AlphaFold model)

Sequence of entity 1 (A, B, C, D), FASTA

>3U8Z_1 Merlin (chains A, B, C, D)
GPLGSQPKTFTVRIVTMDAEMEFNCEMKWKGKDLFDLVCRTLGLRETWFFGLQYTIKDTV
AWLKMDKKVLDHDVSKEEPVTFHFLAKFYPENAEEELVQEITQHLFFLQVKKQILDEKIY
CPPEASVLLASYAVQAKYGDYDPSVHKRGFLAQEELLPKRVINLYQMTPEMWEERITAWY
AEHRGRARDEAEMEYLKIAQDLEMYGVNYFAIRNKKGTELLLGVDALGLHIYDPENRLTP
KISFPWNEIRNISYSDKEFTIKPLDKKIDVFKFNSSKLRVNKLILQLCIGNHDLFMRRRK

Primary citation

Unfurling of the band 4.1, ezrin, radixin, moesin (FERM) domain of the merlin tumor suppressor. Yogesha, S.D., Sharff, A.J., Giovannini, M. et al. Protein Sci (2011) 20:2113-2120. DOI 10.1002/pro.751 · PubMed

Other PDB entries of the same protein (UniProt P35240 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7LWH 1.61 Å, Human neurofibromin 2/merlin residues 1-339 in complex with LATS1
1H4R 1.8 Å, Crystal Structure of the FERM domain of Merlin, the Neurofibromatosis 2 Tumor Suppressor…
4ZRJ 2.3 Å, Structure of Merlin-FERM and CTD
6CDS 2.62 Å, Human neurofibromin 2/merlin/schwannomin residues 1-339 in complex with PIP2
4ZRI 2.7 Å, Crystal structure of Merlin-FERM and Lats2

Browse structure collections

About this viewer

MolViewer shows 3U8Z directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.