7LWH: Human neurofibromin 2/merlin residues 1-339

Human neurofibromin 2/merlin residues 1-339 in complex with LATS1. Determined by X-ray diffraction at 1.61 Å resolution. Released 11 Aug 2021.

Method: X-ray diffraction
Resolution: 1.61 Å
Organism: Homo sapiens
Chains: 2
Atoms: 3,350
Mol. weight: 43.16 kDa
Released: 11 Aug 2021

Explore 7LWH in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7LWH contains 17 α-helices and 16 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 14 helices, 15 β-strands

Element	Residues	Length	Sheet
β-strand	24-27	4	1
β-strand	32-35	4	1
β-strand	42	1	2
α-helix	43-54	12
α-helix	59-61	3
β-strand	62-67	6	1
β-strand	72-74	3	1
β-strand	80	1	2
β-strand	92-98	7	1
α-helix	105-108	4
α-helix	112-127	16
α-helix	135-150	16
α-helix	171-174	4
β-strand	177	1	3
α-helix	181-194	14
α-helix	200-211	12
α-helix	219	1
β-strand	220-226	7	4
β-strand	231-236	6	4
β-strand	240-244	5	4
β-strand	254-257	4	4
α-helix	258-260	3
β-strand	261-267	7	4
β-strand	270-275	6	4
α-helix	281-282	2
β-strand	283-286	4	4
α-helix	290-309	20
α-helix	313-315	3
α-helix	316-336	21

Chain B: 3 helices, 1 β-strand

Element	Residues	Length	Sheet
α-helix	72-74	3
α-helix	75-85	11
α-helix	86-88	3
β-strand	89	1	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Merlin	A	protein	339	Homo sapiens	P35240 (AlphaFold model)
Serine/threonine-protein kinase LATS1	B	protein	23	Homo sapiens	O95835 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>7LWH_1 Merlin (chains A)
MAGAIASRMSFSSLKRKQPKTFTVRIVTMDAEMEFNCEMKWKGKDLFDLVCRTLGLRETW
FFGLQYTIKDTVAWLKMDKKVLDHDVSKEEPVTFHFLAKFYPENAEEELVQEITQHLFFL
QVKKQILDEKIYCPPEASVLLASYAVQAKYGDYDPSVHKRGFLAQEELLPKRVINLYQMT
PEMWEERITVWYAEHRGRARDEAEMEYLKIAQDLEMYGVNYFAIRNKKGTELLLGVDALG
LHIYDPENRLTPKISFPWNEIRNISYSDKEFTIKPLDKKIDVFKFNSSKLRVNKLILQLC
IENHDLFMRRRKADSLEVQQMKAQAREEKARKQMERQRL

Sequence of entity 2 (B), FASTA

>7LWH_2 Serine/threonine-protein kinase LATS1 (chains B)
PKFGTHHKALQEIRNSLLPFANE

Primary citation

Conformational flexibility determines the Nf2/merlin tumor suppressor functions. Primi, M.C., Rangarajan, E.S., Patil, D.N. et al. Matrix Biol Plus (2021) 12:100074-100074. DOI 10.1016/j.mbplus.2021.100074 · PubMed

Other PDB entries of the same protein (UniProt P35240 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1H4R 1.8 Å, Crystal Structure of the FERM domain of Merlin, the Neurofibromatosis 2 Tumor Suppressor…
4ZRJ 2.3 Å, Structure of Merlin-FERM and CTD
6CDS 2.62 Å, Human neurofibromin 2/merlin/schwannomin residues 1-339 in complex with PIP2
3U8Z 2.64 Å, human merlin FERM domain
4ZRI 2.7 Å, Crystal structure of Merlin-FERM and Lats2

Browse structure collections

About this viewer

MolViewer shows 7LWH directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.