Structure of Merlin-FERM and CTD. Determined by X-ray diffraction at 2.3 Å resolution. Released 17 Jun 2015.
Explore 4ZRJ in 3D Show helices and sheets RCSB PDB PDBe
4ZRJ contains 20 α-helices and 16 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 21-27 | 7 | 1 |
| β-strand | 32-38 | 7 | 1 |
| β-strand | 42 | 1 | 2 |
| α-helix | 43-54 | 12 | |
| α-helix | 59-61 | 3 | |
| β-strand | 62-68 | 7 | 1 |
| β-strand | 71-74 | 4 | 1 |
| β-strand | 80 | 1 | 2 |
| α-helix | 81-83 | 3 | |
| β-strand | 92-98 | 7 | 1 |
| α-helix | 105-108 | 4 | |
| α-helix | 112-127 | 16 | |
| α-helix | 135-150 | 16 | |
| α-helix | 171-176 | 6 | |
| β-strand | 177 | 1 | 3 |
| α-helix | 181-192 | 12 | |
| α-helix | 193-195 | 3 | |
| α-helix | 200-211 | 12 | |
| α-helix | 219 | 1 | |
| β-strand | 220-225 | 6 | 4 |
| β-strand | 231-236 | 6 | 4 |
| β-strand | 240-244 | 5 | 4 |
| β-strand | 254-257 | 4 | 4 |
| α-helix | 258-260 | 3 | |
| β-strand | 261-267 | 7 | 4 |
| β-strand | 270-275 | 6 | 4 |
| α-helix | 281-282 | 2 | |
| β-strand | 283-286 | 4 | 4 |
| α-helix | 290-311 | 22 | |
| α-helix | 314-316 | 3 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 513-547 | 35 | |
| β-strand | 550 | 1 | 3 |
| α-helix | 552-554 | 3 | |
| α-helix | 557-562 | 6 | |
| α-helix | 573-581 | 9 | |
| α-helix | 585-594 | 10 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Merlin | A | protein | 320 | Homo sapiens | P35240 (AlphaFold model) |
| Merlin | B | protein | 90 | Homo sapiens | P35240 (AlphaFold model) |
>4ZRJ_1 Merlin (chains A) MAGAIASRMSFSSLKRKQPKTFTVRIVTMDAEMEFNCEMKWKGKDLFDLVCRTLGLRETW FFGLQYTIKDTVAWLKMDKKVLDHDVSKEEPVTFHFLAKFYPENAEEELVQEITQHLFFL QVKKQILDEKIYCPPEASVLLASYAVQAKYGDYDPSVHKRGFLAQEELLPKRVINLYQMT PEMWEERITAWYAEHRGRARDEAEMEYLKIAQDLEMYGVNYFAIRNKKGTELLLGVDALG LHIYDPENRLTPKISFPWNEIRNISYSDKEFTIKPLDKKIDVFKFNSSKLRVNKLILQLC IGNHDLFMRRRKADSLEVQQ
>4ZRJ_2 Merlin (chains B) SFDFKDTDMKRLDMEIEKEKVEYMEKSKHLQEQLNELKTEIEALKLKERETALDILHNEN SDRGGSSKHNTIKKLTLQSWKSRVAFFEEL
Angiomotin binding-induced activation of Merlin/NF2 in the Hippo pathway. Li, Y., Zhou, H., Li, F. et al. Cell Res (2015) 25:801-817. DOI 10.1038/cr.2015.69 · PubMed
Other PDB entries of the same protein (UniProt P35240 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 4ZRJ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.