Crystal structure of Merlin-FERM and Lats2. Determined by X-ray diffraction at 2.7 Å resolution. Released 17 Jun 2015.
Explore 4ZRI in 3D Show helices and sheets RCSB PDB PDBe
4ZRI contains 26 α-helices and 34 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 21-27 | 7 | 1 |
| β-strand | 32-38 | 7 | 1 |
| β-strand | 42 | 1 | 2 |
| α-helix | 43-54 | 12 | |
| α-helix | 59-61 | 3 | |
| β-strand | 62-68 | 7 | 1 |
| β-strand | 71-74 | 4 | 1 |
| β-strand | 80 | 1 | 2 |
| α-helix | 81-83 | 3 | |
| β-strand | 92-98 | 7 | 1 |
| α-helix | 105-108 | 4 | |
| α-helix | 112-127 | 16 | |
| α-helix | 135-150 | 16 | |
| α-helix | 171-174 | 4 | |
| β-strand | 177 | 1 | 3 |
| α-helix | 181-194 | 14 | |
| α-helix | 200-211 | 12 | |
| β-strand | 220-226 | 7 | 4 |
| β-strand | 231-236 | 6 | 4 |
| β-strand | 240-244 | 5 | 4 |
| β-strand | 254-257 | 4 | 4 |
| α-helix | 258-260 | 3 | |
| β-strand | 261-266 | 6 | 4 |
| β-strand | 270-275 | 6 | 4 |
| α-helix | 281-282 | 2 | |
| β-strand | 283-286 | 4 | 4 |
| α-helix | 290-310 | 21 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 22-27 | 6 | 5 |
| β-strand | 32-37 | 6 | 5 |
| β-strand | 42 | 1 | 6 |
| α-helix | 43-54 | 12 | |
| α-helix | 59-61 | 3 | |
| β-strand | 62-68 | 7 | 5 |
| β-strand | 71-74 | 4 | 5 |
| β-strand | 80 | 1 | 6 |
| β-strand | 92-98 | 7 | 5 |
| α-helix | 105-108 | 4 | |
| α-helix | 112-127 | 16 | |
| α-helix | 135-150 | 16 | |
| α-helix | 171-174 | 4 | |
| β-strand | 177 | 1 | 7 |
| α-helix | 181-193 | 13 | |
| α-helix | 200-211 | 12 | |
| β-strand | 220-225 | 6 | 8 |
| β-strand | 231-236 | 6 | 8 |
| β-strand | 240-244 | 5 | 8 |
| β-strand | 245 | 1 | 9 |
| β-strand | 248 | 1 | 9 |
| β-strand | 254-257 | 4 | 8 |
| α-helix | 258-260 | 3 | |
| β-strand | 261-267 | 7 | 8 |
| β-strand | 270-275 | 6 | 8 |
| α-helix | 281-282 | 2 | |
| β-strand | 283-286 | 4 | 8 |
| α-helix | 290-309 | 20 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 74-84 | 11 | |
| α-helix | 85-87 | 3 | |
| β-strand | 88 | 1 | 3 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 74-84 | 11 | |
| β-strand | 88 | 1 | 7 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Merlin | A, B | protein | 324 | Homo sapiens | P35240 (AlphaFold model) |
| Serine/threonine-protein kinase LATS2 | C, D | protein | 32 | Homo sapiens | Q9NRM7 (AlphaFold model) |
>4ZRI_1 Merlin (chains A, B) GPGSMAGAIASRMSFSSLKRKQPKTFTVRIVTMDAEMEFNCEMKWKGKDLFDLVCRTLGL RETWFFGLQYTIKDTVAWLKMDKKVLDHDVSKEEPVTFHFLAKFYPENAEEELVQEITQH LFFLQVKKQILDEKIYCPPEASVLLASYAVQAKYGDYDPSVHKRGFLAQEELLPKRVINL YQMTPEMWEERITAWYAEHRGRARDEAEMEYLKIAQDLEMYGVNYFAIRNKKGTELLLGV DALGLHIYDPENRLTPKISFPWNEIRNISYSDKEFTIKPLDKKIDVFKFNSSKLRVNKLI LQLCIGNHDLFMRRRKADSLEVQQ
>4ZRI_2 Serine/threonine-protein kinase LATS2 (chains C, D) PKFGPYQKALREIRYSLLPFANESGTSAAAEV
Angiomotin binding-induced activation of Merlin/NF2 in the Hippo pathway. Li, Y., Zhou, H., Li, F. et al. Cell Res (2015) 25:801-817. DOI 10.1038/cr.2015.69 · PubMed
Other PDB entries of the same protein (UniProt P35240 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 4ZRI directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.