2QC1: Alpha-bungarotoxin

Crystal structure of the extracellular domain of the nicotinic acetylcholine receptor 1 subunit bound to alpha-bungarotoxin at 1.9 A resolution. Determined by X-ray diffraction at 1.94 Å resolution. Released 7 Aug 2007.

Method: X-ray diffraction
Resolution: 1.94 Å
Organisms: Bungarus multicinctus, Mus musculus
Chains: 2
Atoms: 2,601
Mol. weight: 34.48 kDa
Released: 7 Aug 2007

Explore 2QC1 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2QC1 contains 7 α-helices and 21 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 5 β-strands

Element	Residues	Length	Sheet
β-strand	2-5	4	1
β-strand	12-15	4	1
α-helix	16-17	2
β-strand	22-28	7	2
α-helix	33-36	4
β-strand	39-45	7	2
α-helix	48-51	4
β-strand	56-60	5	2

Chain B: 4 helices, 16 β-strands

Element	Residues	Length	Sheet
α-helix	2-12	11
α-helix	28	1
β-strand	29-44	16	3
β-strand	49-61	13	3
α-helix	69-72	4
β-strand	77-80	4	3
α-helix	82-84	3
β-strand	90-92	3	4
β-strand	95	1	3
β-strand	102-103	2	3
β-strand	108-111	4	3
β-strand	115-118	4	3
β-strand	121-127	7	3
β-strand	128-130	3	4
β-strand	139-148	10	4
β-strand	156-160	5	3
β-strand	166	1	3
β-strand	176-188	13	4
β-strand	189-190	2	2
β-strand	198-209	12	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Alpha-bungarotoxin	A	protein	74	Bungarus multicinctus	P60616 (AlphaFold model)
Acetylcholine receptor subunit alpha	B	protein	212	Mus musculus	P04756 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2QC1_1 Alpha-bungarotoxin (chains A)
IVCHTTATSPISAVTCPPGENLCYRKMWCDVFCSSRGKVVELGCAATCPSKKPYEEVTCC
STDKCNPHPKQRPG

Sequence of entity 2 (B), FASTA

>2QC1_2 Acetylcholine receptor subunit alpha (chains B)
KSEHETRLEAKLFEDYSSVVRPVEDHREIVQVTVGLQLIQLINVDEVNQIVTTNVRLKQQ
WVDYNLKWNPDDYGGVKKIHIPSEKIWRPDVVLYNNADGDFAIVKFTKVLLDYTGHITWT
PPAIFKSYCEIIVTHFPFDEQNCSMKLGTRTYDGSAVAINPESDQPDLSNFMESGEWVIK
EARGWKHWVFYSCCPTTPYLDITYHFVMQRLP

Primary citation

Crystal structure of the extracellular domain of nAChR alpha1 bound to alpha-bungarotoxin at 1.94 A resolution. Dellisanti, C.D., Yao, Y., Stroud, J.C. et al. Nat Neurosci (2007) 10:953-962. DOI 10.1038/nn1942 · PubMed

Other PDB entries of the same protein (UniProt P60616 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1HC9 1.8 Å, alpha-bungarotoxin complexed with high affinity peptide
5HBT 2.61 Å, Complex structure of Fab35 and human nAChR alpha1
4UY2 2.7 Å, Crystal structure of the complex of the extracellular domain of human alpha9 nAChR with…
5HBV 2.7 Å, Complex structure of Fab35 and mouse nAChR alpha1
7KOO 3.0 Å, Alpha-7 nicotinic acetylcholine receptor bound to alpha-bungarotoxin in a resting state
4HQP 3.51 Å, Alpha7 nicotinic receptor chimera and its complex with Alpha bungarotoxin

Browse structure collections

About this viewer

MolViewer shows 2QC1 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.