1HF0: DNA-binding domain of Oct-1

Name: PDB 1HF0: Crystal structure of the DNA-binding domain of Oct-1 bound to DNA as a dimer
Published: 2001-11-10
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: transcription

Crystal structure of the DNA-binding domain of Oct-1 bound to DNA as a dimer. Determined by X-ray diffraction at 2.7 Å resolution. Released 10 Nov 2001.

Method: X-ray diffraction
Resolution: 2.7 Å
Organism: HOMO SAPIENS
Chains: 4
Atoms: 3,079
Mol. weight: 50.16 kDa
Released: 10 Nov 2001

Explore 1HF0 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1HF0 contains 15 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 0 β-strands

Element	Residues	Length
α-helix	7-22	16
α-helix	27-37	11
α-helix	44-51	8
α-helix	57-74	18
α-helix	110-122	13
α-helix	128-138	11
α-helix	142-156	15

Chain B: 8 helices, 0 β-strands

Element	Residues	Length
α-helix	7-23	17
α-helix	27-36	10
α-helix	44-51	8
α-helix	57-74	18
α-helix	103-107	5
α-helix	110-122	13
α-helix	128-138	11
α-helix	142-156	15

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Octamer-binding transcription factor 1	A, B	protein	159	HOMO SAPIENS	P14859 (AlphaFold model)
DNA 5'-d(cpapcpaptptptpgpapapapgpgp cpapapaptpgpgpapg)-3'	M	DNA	22
DNA 5'-d(cptpcpcpaptptptpgpcpcptptp tpcpapapaptpgptpg)-3'	N	DNA	22

Sequence of entity 1 (A, B), FASTA

>1HF0_1 OCTAMER-BINDING TRANSCRIPTION FACTOR 1 (chains A, B)
EEPSDLEELEQFAKTFKQRRIKLGFTQGDVGLAMGKLYGNDFSQTTISRFEALNLSFKNM
SKLKPLLEKWLNDAENLSSDSSLSSPSALNSPGIEGLSRRRKKRTSIETNIRVALEKSFL
ENQKPTSEEITMIADQLNMEKEVIRVWFSNRRQKEKRIN

Sequence of entity 2 (M), FASTA

>1HF0_2 DNA 5'-D(*CP*AP*CP*AP*TP*TP*TP*GP*AP*AP*AP*GP*GP* CP*AP*AP*AP*TP*GP*GP*AP*G)-3' (chains M)
CACATTTGAAAGGCAAATGGAG

Sequence of entity 3 (N), FASTA

>1HF0_3 DNA 5'-D(*CP*TP*CP*CP*AP*TP*TP*TP*GP*CP*CP*TP*TP* TP*CP*AP*AP*AP*TP*GP*TP*G)-3' (chains N)
CTCCATTTGCCTTTCAAATGTG

Primary citation

Differential Dimer Activities of the Transcription Factor Oct-1 by DNA-Induced Interface Swapping. Remenyi, A., Tomilin, A., Pohl, E. et al. Mol Cell (2001) 8:569. DOI 10.1016/S1097-2765(01)00336-7 · PubMed

Other PDB entries of the same protein (UniProt P14859 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1E3O 1.9 Å, Crystal structure of Oct-1 POU dimer bound to MORE
1GT0 2.6 Å, Crystal structure of a POU/HMG/DNA ternary complex
1OCT 3.0 Å, Crystal structure of the oct-1 pou domain bound to an octamer site: DNA recognition with…
1CQT 3.2 Å, Crystal structure of a ternary complex containing an oca-B peptide, the oct-1 pou…
1O4X Ternary complex of the DNA binding domains of the OCT1 and SOX2 transcription factors…
1POG Solution structure of the oct-1 pou-homeo domain determined by NMR and restrained…
1POU The solution structure of the oct-1 pou-specific domain reveals a striking similarity to…

Browse structure collections

About this viewer

MolViewer shows 1HF0 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.