1HJZ: AF1521 protein containing a macroH2A domain

Crystal structure of AF1521 protein containing a macroH2A domain. Determined by X-ray diffraction at 1.7 Å resolution. Released 10 Jul 2003.

Method: X-ray diffraction
Resolution: 1.7 Å
Organism: ARCHAEOGLOBUS FULGIDUS
Chains: 2
Atoms: 3,249
Mol. weight: 42.36 kDa
Released: 10 Jul 2003

Explore 1HJZ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1HJZ contains 14 α-helices and 14 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A and B: 7 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	2-9	8	1
β-strand	12-18	7	1
α-helix	21-23	3
β-strand	28-33	6	1
α-helix	42-52	11
α-helix	55-70	16
β-strand	81-84	4	1
α-helix	86-91	6
β-strand	95-100	6	1
α-helix	110-130	21
β-strand	134-137	4	1
α-helix	149-162	14
β-strand	170-175	6	1
α-helix	178-191	14

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Hypothetical protein AF1521	A, B	protein	192	ARCHAEOGLOBUS FULGIDUS	O28751 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>1HJZ_1 HYPOTHETICAL PROTEIN AF1521 (chains A, B)
MEVLFEAKVGDITLKLAQGDITQYPAKAIVNAANKRLEHGGGVAYAIAKACAGDAGLYTE
ISKKAMREQFGRDYIDHGEVVVTPAMNLEERGIKYVFHTVGPICSGMWSEELKEKLYKAF
LGPLEKAEEMGVESIAFPAVSAGIYGCDLEKVVETFLEAVKNFKGSAVKEVALVIYDRKS
AEVALKVFERSL

Primary citation

The Crystal Structure of Af1521 a Protein from Archaeoglobus Fulgidus with Homology to the Non-Histone Domain of Macroh2A. Allen, M.D., Buckle, A.M., Cordell, S.C. et al. J Mol Biol (2003) 330:503. DOI 10.1016/S0022-2836(03)00473-X · PubMed

Other PDB entries of the same protein (UniProt O28751 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1VHU 1.34 Å, Crystal structure of a putative phosphoesterase
2BFQ 1.5 Å, Macro domains are ADP-ribose binding molecules
6FX7 1.82 Å, Crystal structure of in vitro evolved Af1521
7WR6 1.96 Å, Crystal structure of ADP-riboxanated caspase-4 in complex with Af1521
2BFR 2.5 Å, The Macro domain is an ADP-ribose binding module

Browse structure collections

About this viewer

MolViewer shows 1HJZ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.