1VHU: Putative phosphoesterase

Crystal structure of a putative phosphoesterase. Determined by X-ray diffraction at 1.34 Å resolution. Released 30 Dec 2003.

Method: X-ray diffraction
Resolution: 1.34 Å
Organism: Archaeoglobus fulgidus
Chains: 1
Atoms: 1,778
Mol. weight: 23.72 kDa
Released: 30 Dec 2003

Explore 1VHU in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1VHU contains 7 α-helices and 7 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	9-16	8	1
β-strand	19-25	7	1
α-helix	28-30	3
β-strand	35-40	6	1
α-helix	49-59	11
α-helix	62-77	16
β-strand	88-91	4	1
α-helix	93-98	6
β-strand	102-107	6	1
α-helix	117-137	21
β-strand	141-144	4	1
α-helix	156-169	14
β-strand	177-182	6	1
α-helix	185-198	14

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Hypothetical protein AF1521	A	protein	211	Archaeoglobus fulgidus	O28751 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1VHU_1 Hypothetical protein AF1521 (chains A)
MSLERRTLIMEVLFEAKVGDITLKLAQGDITQYPAKAIVNAANKRLEHGGGVAYAIAKAC
AGDAGLYTEISKKAMREQFGRDYIDHGEVVVTPAMNLEERGIKYVFHTVGPICSGMWSEE
LKEKLYKAFLGPLEKAEEMGVESIAFPAVSAGIYGCDLEKVVETFLEAVKNFKGSAVKEV
ALVIYDRKSAEVALKVFERSLEGGSHHHHHH

Primary citation

Structural analysis of a set of proteins resulting from a bacterial genomics project. Badger, J., Sauder, J.M., Adams, J.M. et al. Proteins (2005) 60:787-796. DOI 10.1002/prot.20541 · PubMed

Other PDB entries of the same protein (UniProt O28751 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2BFQ 1.5 Å, Macro domains are ADP-ribose binding molecules
1HJZ 1.7 Å, Crystal structure of AF1521 protein containing a macroH2A domain
6FX7 1.82 Å, Crystal structure of in vitro evolved Af1521
7WR6 1.96 Å, Crystal structure of ADP-riboxanated caspase-4 in complex with Af1521
2BFR 2.5 Å, The Macro domain is an ADP-ribose binding module

Browse structure collections

About this viewer

MolViewer shows 1VHU directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.