2BFR: The Macro domain is an ADP-ribose binding module

The Macro domain is an ADP-ribose binding module. Determined by X-ray diffraction at 2.5 Å resolution. Released 16 Dec 2004.

Method: X-ray diffraction
Resolution: 2.5 Å
Organism: ARCHAEOGLOBUS FULGIDUS
Chains: 1
Atoms: 1,543
Mol. weight: 21.46 kDa
Ligands: ADP, MG
Released: 16 Dec 2004

Explore 2BFR in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2BFR contains 7 α-helices and 7 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	2-9	8	1
β-strand	12-18	7	1
α-helix	21-23	3
β-strand	28-33	6	1
α-helix	42-52	11
α-helix	55-70	16
β-strand	81-84	4	1
α-helix	86-91	6
β-strand	95-100	6	1
α-helix	110-130	21
β-strand	134-137	4	1
α-helix	149-162	14
β-strand	170-175	6	1
α-helix	178-191	14

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Hypothetical protein AF1521	A	protein	192	ARCHAEOGLOBUS FULGIDUS	O28751 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2BFR_1 HYPOTHETICAL PROTEIN AF1521 (chains A)
MEVLFEAKVGDITLKLAQGDITQYPAKAIVNAANKRLEHGGGVAYAIAKACAGDAGLYTE
ISKKAMREQFGRDYIDHGEVVVTPAMNLEERGIKYVFHTVGPICSGMWSEELKEKLYKAF
LGPLEKAEEMGVESIAFPAVSAGIYGCDLEKVVETFLEAVKNFKGSAVKEVALVIYDRKS
AEVALKVFERSL

Ligands and cofactors

ID	Name	Formula	Copies
ADP	Adenosine-5'-diphosphate	C10 H15 N5 O10 P2	1
MG	Magnesium ion	Mg	1

Primary citation

The Macro Domain is an Adp-Ribose Binding Module. Karras, G.I., Kustatscher, G., Buhecha, H.R. et al. EMBO J (2005) 24:1911. DOI 10.1038/SJ.EMBOJ.7600664 · PubMed

Other PDB entries of the same protein (UniProt O28751 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1VHU 1.34 Å, Crystal structure of a putative phosphoesterase
2BFQ 1.5 Å, Macro domains are ADP-ribose binding molecules
1HJZ 1.7 Å, Crystal structure of AF1521 protein containing a macroH2A domain
6FX7 1.82 Å, Crystal structure of in vitro evolved Af1521
7WR6 1.96 Å, Crystal structure of ADP-riboxanated caspase-4 in complex with Af1521

Browse structure collections

About this viewer

MolViewer shows 2BFR directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.