6FX7: In vitro evolved Af1521

Crystal structure of in vitro evolved Af1521. Determined by X-ray diffraction at 1.82 Å resolution. Released 25 Sept 2019.

Method: X-ray diffraction
Resolution: 1.82 Å
Organism: Archaeoglobus fulgidus DSM 4304
Chains: 1
Atoms: 1,642
Mol. weight: 24.14 kDa
Ligands: AR6
Released: 25 Sept 2019

Explore 6FX7 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6FX7 contains 7 α-helices and 7 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	2-9	8	1
β-strand	12-18	7	1
α-helix	21-23	3
β-strand	28-33	6	1
α-helix	42-52	11
α-helix	55-70	16
β-strand	81-84	4	1
α-helix	86-91	6
β-strand	95-100	6	1
α-helix	110-129	20
β-strand	134-137	4	1
α-helix	149-162	14
β-strand	170-175	6	1
α-helix	178-191	14

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
[Protein ADP-ribosylglutamate] hydrolase AF_1521	A	protein	215	Archaeoglobus fulgidus DSM 4304	O28751 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>6FX7_1 [Protein ADP-ribosylglutamate] hydrolase AF_1521 (chains A)
MGHHHHHHHHHHSSGHIDDDDKHMEVLFEAKVGDITLRLAQGDITQYPAKAIVNAANERL
EHGGGVAYAIAKACAGDAGLYTEISKKAMREQFGRDCIDHGEVVVTPAMNLEERGIKYVL
HTVGPVCGGMWSGELKEKLYKAFLGPLEKAEEMGVESIAFPAVSAGIRGCDLEKVVETFL
EAVKDFKGSAVKEVALVIYDRKSAEVALKVFERSL

Ligands and cofactors

ID	Name	Formula	Copies
AR6	[(2R,3S,4R,5R)-5-(6-aminopurin-9-yl)-3,4-dihydroxy-oxolan-2-yl]methyl[hydroxy-[…	C15 H23 N5 O14 P2	1

Primary citation

Engineering Af1521 improves ADP-ribose binding and identification of ADP-ribosylated proteins. Nowak, K., Rosenthal, F., Karlberg, T. et al. Nat Commun (2020) 11:5199-5199. DOI 10.1038/s41467-020-18981-w · PubMed

Other PDB entries of the same protein (UniProt O28751 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1VHU 1.34 Å, Crystal structure of a putative phosphoesterase
2BFQ 1.5 Å, Macro domains are ADP-ribose binding molecules
1HJZ 1.7 Å, Crystal structure of AF1521 protein containing a macroH2A domain
7WR6 1.96 Å, Crystal structure of ADP-riboxanated caspase-4 in complex with Af1521
2BFR 2.5 Å, The Macro domain is an ADP-ribose binding module

Browse structure collections

About this viewer

MolViewer shows 6FX7 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.