1I10: L-lactate dehydrogenase M chain

Human muscle L-lactate dehydrogenase M chain, ternary complex with NADH and oxamate. Determined by X-ray diffraction at 2.3 Å resolution. Released 28 Mar 2001.

Method: X-ray diffraction
Resolution: 2.3 Å
Organism: Homo sapiens
Chains: 8
Atoms: 21,581
Mol. weight: 299.34 kDa
Ligands: NAI, OXM
Released: 28 Mar 2001

Explore 1I10 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1I10 contains 131 α-helices and 123 β-strands across 8 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 17 helices, 16 β-strands

Element	Residues	Length	Sheet
α-helix	3-7	5
β-strand	8-10	3	1
β-strand	21-25	5	2
α-helix	29-40	12
β-strand	46-50	5	2
α-helix	54-65	12
α-helix	68-70	3
β-strand	75-78	4	2
α-helix	82-85	4
β-strand	90-93	4	2
α-helix	99-100	2
α-helix	105-108	4
α-helix	109-126	18
β-strand	131-134	4	2
α-helix	139-150	12
α-helix	154-156	3
β-strand	157-159	3	2
α-helix	163-177	15
α-helix	181-183	3
β-strand	185	1	3
β-strand	188-189	2	4
β-strand	190	1	2
β-strand	197-198	2	4
α-helix	200-202	3
β-strand	204-205	2	3
β-strand	208-209	2	3
α-helix	210-213	4
α-helix	227-244	18
α-helix	249-263	15
β-strand	268-275	8	2
β-strand	287-295	9	2
β-strand	298-303	6	2
α-helix	309-326	18

Chain B: 17 helices, 16 β-strands

Element	Residues	Length	Sheet
α-helix	3-7	5
β-strand	8-10	3	5
β-strand	21-25	5	6
α-helix	29-40	12
β-strand	46-50	5	6
α-helix	54-65	12
α-helix	68-70	3
β-strand	75-78	4	6
α-helix	82-85	4
β-strand	88-93	6	6
α-helix	105-108	4
α-helix	109-126	18
α-helix	130	1
β-strand	131-134	4	6
α-helix	139-150	12
α-helix	154-156	3
β-strand	157-159	3	6
α-helix	163-177	15
α-helix	181-183	3
β-strand	185	1	7
β-strand	188-189	2	8
β-strand	190	1	6
β-strand	197-198	2	8
α-helix	200-202	3
β-strand	204-205	2	7
β-strand	208-209	2	7
α-helix	210-213	4
α-helix	227-244	18
α-helix	249-263	15
β-strand	268-275	8	6
β-strand	287-295	9	6
β-strand	298-303	6	6
α-helix	309-327	19

Chain C: 17 helices, 16 β-strands

Element	Residues	Length	Sheet
α-helix	3-7	5
β-strand	8-10	3	6
β-strand	21-25	5	5
α-helix	29-40	12
β-strand	46-50	5	5
α-helix	54-66	13
α-helix	68-70	3
β-strand	75-78	4	5
α-helix	82-85	4
β-strand	90-93	4	5
α-helix	105-108	4
α-helix	109-126	18
α-helix	130	1
β-strand	131-134	4	5
α-helix	139-150	12
α-helix	154-156	3
β-strand	157-159	3	5
α-helix	163-177	15
α-helix	181-183	3
β-strand	185	1	9
β-strand	188-189	2	10
β-strand	190	1	5
β-strand	197-198	2	10
α-helix	200-202	3
β-strand	204-205	2	9
β-strand	208-209	2	9
α-helix	210-213	4
α-helix	227-244	18
α-helix	249-263	15
β-strand	268-275	8	5
β-strand	287-295	9	5
β-strand	298-303	6	5
α-helix	309-327	19

Chain D: 17 helices, 15 β-strands

Element	Residues	Length	Sheet
α-helix	3-7	5
β-strand	8-10	3	2
β-strand	21-25	5	1
α-helix	29-40	12
β-strand	46-50	5	1
α-helix	54-66	13
α-helix	68-70	3
β-strand	75-78	4	1
α-helix	82-85	4
β-strand	90-93	4	1
α-helix	97-99	3
α-helix	106-126	21
α-helix	130	1
β-strand	131-134	4	1
α-helix	139-150	12
α-helix	154-156	3
β-strand	157-159	3	1
α-helix	163-177	15
α-helix	181-183	3
β-strand	184-185	2	11
β-strand	188-190	3	1
β-strand	196-198	3	1
α-helix	200-202	3
β-strand	204-205	2	11
β-strand	208-209	2	11
α-helix	210-213	4
α-helix	227-244	18
α-helix	249-263	15
β-strand	268-275	8	1
β-strand	287-296	10	1
β-strand	298-303	6	1
α-helix	309-326	18

Chain E: 16 helices, 15 β-strands

Element	Residues	Length	Sheet
α-helix	3-7	5
β-strand	8-10	3	12
β-strand	21-25	5	13
α-helix	29-39	11
β-strand	46-50	5	13
α-helix	54-65	12
α-helix	68-70	3
β-strand	76-78	3	13
α-helix	82-85	4
β-strand	90-93	4	13
α-helix	109-126	18
α-helix	130	1
β-strand	131-134	4	13
α-helix	139-150	12
α-helix	154-156	3
β-strand	157-159	3	13
α-helix	163-176	14
α-helix	181-183	3
β-strand	185	1	14
β-strand	188-190	3	13
β-strand	196-198	3	13
α-helix	200-202	3
β-strand	204-205	2	14
β-strand	208-209	2	14
α-helix	227-234	8
α-helix	236-244	9
α-helix	249-263	15
β-strand	268-275	8	13
β-strand	287-295	9	13
β-strand	298-303	6	13
α-helix	312-328	17

Chain F: 16 helices, 14 β-strands

Element	Residues	Length	Sheet
α-helix	3-7	5
β-strand	8-10	3	15
β-strand	21-25	5	16
α-helix	29-39	11
β-strand	46-50	5	16
α-helix	54-66	13
α-helix	68-70	3
β-strand	75-78	4	16
α-helix	82-85	4
β-strand	90-93	4	16
α-helix	105-108	4
α-helix	109-126	18
α-helix	130	1
β-strand	131-134	4	16
α-helix	139-150	12
α-helix	154-156	3
β-strand	157-159	3	16
α-helix	163-177	15
α-helix	181-183	3
β-strand	185-189	5	17
β-strand	190	1	16
β-strand	197-205	9	17
β-strand	208-209	2	17
α-helix	210-213	4
α-helix	227-244	18
α-helix	249-263	15
β-strand	268-275	8	16
β-strand	287-295	9	16
β-strand	298-303	6	16
α-helix	309-329	21

Chain G: 14 helices, 15 β-strands

Element	Residues	Length	Sheet
α-helix	3-7	5
β-strand	8-10	3	16
β-strand	21-25	5	15
α-helix	29-40	12
β-strand	46-50	5	15
α-helix	54-65	12
α-helix	68-70	3
β-strand	75-78	4	15
α-helix	82-85	4
β-strand	90-93	4	15
α-helix	108-126	19
β-strand	131-134	4	15
α-helix	139-150	12
α-helix	154-156	3
β-strand	157-159	3	15
α-helix	163-177	15
α-helix	181-183	3
β-strand	184-185	2	18
β-strand	188-190	3	15
β-strand	196-198	3	15
α-helix	200-202	3
β-strand	204-205	2	18
β-strand	208-209	2	18
α-helix	228-244	17
α-helix	249-263	15
β-strand	268-275	8	15
β-strand	287-295	9	15
β-strand	298-303	6	15
α-helix	309-327	19

Chain H: 17 helices, 16 β-strands

Element	Residues	Length	Sheet
α-helix	3-7	5
β-strand	8-10	3	13
β-strand	21-25	5	12
α-helix	29-40	12
β-strand	46-50	5	12
α-helix	54-66	13
α-helix	68-70	3
β-strand	75-78	4	12
α-helix	82-85	4
β-strand	90-93	4	12
α-helix	99-100	2
α-helix	105-108	4
α-helix	109-126	18
β-strand	131-134	4	12
α-helix	139-150	12
α-helix	154-156	3
β-strand	157-159	3	12
α-helix	163-177	15
α-helix	181-183	3
β-strand	185	1	19
β-strand	188-189	2	20
β-strand	190	1	12
β-strand	197-198	2	20
α-helix	200-202	3
β-strand	204-205	2	19
β-strand	208-209	2	19
α-helix	210-213	4
α-helix	227-244	18
α-helix	249-263	15
β-strand	268-275	8	12
β-strand	287-295	9	12
β-strand	298-303	6	12
α-helix	309-329	21

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
L-lactate dehydrogenase M chain	A, B, C, D, E, F, G, H	protein	331	Homo sapiens	P00338 (AlphaFold model)

Sequence of entity 1 (A, B, C, D, E, F, G, H), FASTA

>1I10_1 L-LACTATE DEHYDROGENASE M CHAIN (chains A, B, C, D, E, F, G, H)
ATLKDQLIYNLLKEEQTPQNKITVVGVGAVGMACAISILMKDLADELALVDVIEDKLKGE
MMDLQHGSLFLRTPKIVSGKDYNVTANSKLVIITAGARQQEGESRLNLVQRNVNIFKFII
PNVVKYSPNCKLLIVSNPVDILTYVAWKISGFPKNRVIGSGCNLDSARFRYLMGERLGVH
PLSCHGWVLGEHGDSSVPVWSGMNVAGVSLKTLHPDLGTDKDKEQWKEVHKQVVESAYEV
IKLKGYTSWAIGLSVADLAESIMKNLRRVHPVSTMIKGLYGIKDDVFLSVPCILGQNGIS
DLVKVTLTSEEEARLKKSADTLWGIQKELQF

Ligands and cofactors

ID	Name	Formula	Copies
NAI	1,4-dihydronicotinamide adenine dinucleotide	C21 H29 N7 O14 P2	8
OXM	Oxamic acid	C2 H3 N O3	8

Water and common crystallization additives (ACT) are not listed.

Primary citation

Structural basis for altered activity of M- and H-isozyme forms of human lactate dehydrogenase. Read, J.A., Winter, V.J., Eszes, C.M. et al. Proteins (2001) 43:175-185. DOI 10.1002/1097-0134(20010501)43:2<175::AID-PROT1029>3.0.CO;2-# · PubMed

Other PDB entries of the same protein (UniProt P00338 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5W8J 1.55 Å, Crystal Structure of Lactate Dehydrogenase A in complex with inhibitor compound 29
5W8K 1.6 Å, Crystal Structure of Lactate Dehydrogenase A in complex with inhibitor compound 29 and…
5W8H 1.8 Å, Crystal Structure of Lactate Dehydrogenase A in complex with inhibitor compound 11
9BK2 1.85 Å, Crystal structure of Lactate dehydrogenase in complex with…
4JNK 1.9 Å, Lactate Dehydrogenase A in complex with inhibitor compound 22
4RLS 1.91 Å, Lactate Dehydrogenase in complex with inhibitor compound 47
5W8I 1.95 Å, Crystal Structure of Lactate Dehydrogenase A in complex with inhibitor compound 23 and…
5W8L 1.95 Å, Crystal Structure of Lactate Dehydrogenase A in complex with inhibitor compound 59 and…
6BB0 1.95 Å, Lactate Dehydrogenase in complex with inhibitor (R)-3-((2-chlorophenyl)thio)-6-(3-((4-flu…
6MV8 1.95 Å, LDHA structure in complex with inhibitor 14
6Q13 2.0 Å, Crystal structure of ldha in complex with compound NCGC00420737-09 at 2.00 a resolution
4QO8 2.0 Å, Lactate Dehydrogenase A in complex with substituted 3-Hydroxy-2-mercaptocyclohex-2-enone…

Browse more

1I10 is part of these collections:

Metabolism and cellular energy

About this viewer

MolViewer shows 1I10 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.