Crystal structure of human mitotic-specific ubiquitin-conjugating enzyme, UBCH10. Determined by X-ray diffraction at 1.95 Å resolution. Released 4 Apr 2001.
Explore 1I7K in 3D Show helices and sheets RCSB PDB PDBe
1I7K contains 14 α-helices and 16 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 31-45 | 15 | |
| β-strand | 50-55 | 6 | 1 |
| β-strand | 58-67 | 10 | 1 |
| β-strand | 68 | 1 | 2 |
| α-helix | 69 | 1 | |
| β-strand | 75 | 1 | 2 |
| β-strand | 78-84 | 7 | 1 |
| α-helix | 93-94 | 2 | |
| β-strand | 95-98 | 4 | 1 |
| β-strand | 107 | 1 | 3 |
| β-strand | 112 | 1 | 1 |
| β-strand | 113 | 1 | 3 |
| α-helix | 116-118 | 3 | |
| α-helix | 128-140 | 13 | |
| α-helix | 150-155 | 6 | |
| α-helix | 159-171 | 13 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 31-45 | 15 | |
| β-strand | 50-55 | 6 | 4 |
| β-strand | 58-67 | 10 | 4 |
| α-helix | 68-69 | 2 | |
| β-strand | 78-84 | 7 | 4 |
| α-helix | 93-94 | 2 | |
| β-strand | 95-98 | 4 | 4 |
| β-strand | 107 | 1 | 5 |
| β-strand | 112 | 1 | 4 |
| β-strand | 113 | 1 | 5 |
| α-helix | 116-118 | 3 | |
| α-helix | 128-140 | 13 | |
| α-helix | 150-155 | 6 | |
| α-helix | 159-172 | 14 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Ubiquitin-conjugating enzyme E2 H10 | A, B | protein | 179 | Homo sapiens | O00762 (AlphaFold model) |
>1I7K_1 UBIQUITIN-CONJUGATING ENZYME E2 H10 (chains A, B) MASQNRDPAATSVAAARKGAEPSGGAARGPVGKRLQQELMTLMMSGDKGISAFPESDNLF KWVGTIHGAAGTVYEDLRYKLSLEFPSGYPYNAPTVKFLTPCYHPNVDTQGNISLDILKE KWSALYDVRTILLSIQSLLGEPNIDSPLNTHAAELWKNPTAFKKYLQETYSKQVTSQEP
Structural and functional analysis of the human mitotic-specific ubiquitin-conjugating enzyme, UbcH10. Lin, Y., Hwang, W.C., Basavappa, R. J Biol Chem (2002) 277:21913-21921. DOI 10.1074/jbc.M109398200 · PubMed
Other PDB entries of the same protein (UniProt O00762 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1I7K directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.