Structure of myb transforming protein, NMR, minimized average structure. Determined by solution NMR. Released 23 Dec 1996.
Explore 1IDY in 3D Show helices and sheets RCSB PDB PDBe
1IDY contains 4 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 149-161 | 13 | |
| α-helix | 166-172 | 7 | |
| α-helix | 178-187 | 10 | |
| α-helix | 189-191 | 3 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Mouse C-myb DNA-binding domain repeat 3 | A | protein | 54 | Mus musculus | P06876 (AlphaFold model) |
>1IDY_1 MOUSE C-MYB DNA-BINDING DOMAIN REPEAT 3 (chains A) MEVKKTSWTEEEDRILYQAHKRLGNRWAEIAKLLPGRTDNAIKNHWNSTMRRKV
A small engineered protein lacks structural uniqueness by increasing the side-chain conformational entropy. Furukawa, K., Oda, M., Nakamura, H. Proc Natl Acad Sci U S A (1996) 93:13583-13588. DOI 10.1073/pnas.93.24.13583 · PubMed
Other PDB entries of the same protein (UniProt P06876 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1IDY directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.