The third IgG-binding domain from streptococcal protein G: an analysis by X-ray crystallography of the structure alone and in a complex with FAB. Determined by X-ray diffraction at 1.1 Å resolution. Released 1 Nov 1994.
Explore 1IGD in 3D Show helices and sheets RCSB PDB PDBe
1IGD contains 2 α-helices and 4 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 2-4 | 3 | |
| β-strand | 6-13 | 8 | 1 |
| β-strand | 18-25 | 8 | 1 |
| α-helix | 28-41 | 14 | |
| β-strand | 47-51 | 5 | 1 |
| β-strand | 56-60 | 5 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Protein G | A | protein | 61 | Streptococcus sp. G148 | P06654 (AlphaFold model) |
>1IGD_1 PROTEIN G (chains A) MTPAVTTYKLVINGKTLKGETTTKAVDAETAEKAFKQYANDNGVDGVWTYDDATKTFTVT E
The third IgG-binding domain from streptococcal protein G. An analysis by X-ray crystallography of the structure alone and in a complex with Fab. Derrick, J.P., Wigley, D.B. J Mol Biol (1994) 243:906-918. DOI 10.1006/jmbi.1994.1691 · PubMed
Other PDB entries of the same protein (UniProt P06654 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1IGD directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.