X-ray structure of synthetic GB1 domain with mutations K10(DVA), T11S. Determined by X-ray diffraction at 1.73 Å resolution. Released 12 Aug 2020.
Explore 6L9D in 3D Show helices and sheets RCSB PDB PDBe
6L9D contains 1 α-helix and 4 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 2-8 | 7 | 1 |
| β-strand | 13-19 | 7 | 1 |
| α-helix | 23-36 | 14 | |
| β-strand | 42-46 | 5 | 1 |
| β-strand | 51-55 | 5 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Immunoglobulin G-binding protein G | A | protein | 56 | Streptococcus sp. group G | P06654 (AlphaFold model) |
>6L9D_1 Immunoglobulin G-binding protein G (chains A) DTYKLILNGVSLKGETTTEAVDAATAEKVFKQYANDNGVDGEWTYDDATKTFTVTE
Increasing protein stability by engineering the n -> pi * interaction at the beta-turn. Khatri, B., Majumder, P., Nagesh, J. et al. Chem Sci (2020) 11:9480-9487. DOI 10.1039/d0sc03060k · PubMed
Other PDB entries of the same protein (UniProt P06654 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 6L9D directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.