Anisotropic structure of protein G IgG-binding domain III at 1.1 Å resolution. Determined by X-ray diffraction at 1.1 Å resolution. Released 29 Jul 1998.
Explore 2IGD in 3D Show helices and sheets RCSB PDB PDBe
2IGD contains 2 α-helices and 4 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 2-4 | 3 | |
| β-strand | 6-13 | 8 | 1 |
| β-strand | 18-25 | 8 | 1 |
| α-helix | 28-41 | 14 | |
| β-strand | 47-51 | 5 | 1 |
| β-strand | 56-60 | 5 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Protein G | A | protein | 61 | Streptococcus sp. | P06654 (AlphaFold model) |
>2IGD_1 PROTEIN G (chains A) MTPAVTTYKLVINGKTLKGETTTKAVDAETAEKAFKQYANDNGVDGVWTYDDATKTFTVT E
Anisotropic Refinement of a Protein G Domain at 1.1 Angstrom Resolution. Butterworth, S., Lamzin, V.S., Wigley, D.B. et al. To be published.
Other PDB entries of the same protein (UniProt P06654 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 2IGD directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.