4KGR: PDB entry 4KGR

Backbone Modifications in the Protein GB1 Helix: beta-3-Ala24, beta-3-Lys28, beta-3-Lys31, beta-3-Asn35. Determined by X-ray diffraction at 2.0 Å resolution. Released 4 Sept 2013.

Method: X-ray diffraction
Resolution: 2.0 Å
Chains: 8
Atoms: 3,731
Mol. weight: 49.99 kDa
Released: 4 Sept 2013

Explore 4KGR in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4KGR contains 13 α-helices and 32 β-strands across 8 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A, B and H: 1 helix, 4 β-strands

Element	Residues	Length	Sheet
β-strand	2-8	7	1
β-strand	13-19	7	1
α-helix	23-36	14
β-strand	42-46	5	1
β-strand	51-55	5	1

Chains C, D, E, F and G: 2 helices, 4 β-strands

Element	Residues	Length	Sheet
β-strand	2-8	7	2
β-strand	13-19	7	2
α-helix	23-36	14
β-strand	42-46	5	2
α-helix	47-49	3
β-strand	51-55	5	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Streptococcal Protein GB1 Backbone Modified Variant: beta-3-Ala24, beta-3-Lys28, beta-3-Lys31,…	A, B, C, D, E, F, G, H	protein	57		P06654 (AlphaFold model)

Sequence of entity 1 (A, B, C, D, E, F, G, H), FASTA

>4KGR_1 Streptococcal Protein GB1 Backbone Modified Variant: beta-3-Ala24, beta-3-Lys28, beta-3-Lys31, beta-3-Asn35 (chains A, B, C, D, E, F, G, H)
DTYKLILNGKTLKGETTTEAVDAATAEKVFKQYANDNGVDGEWTYDDATKTFTVTEX

Primary citation

Protein-like Tertiary Folding Behavior from Heterogeneous Backbones. Reinert, Z.E., Lengyel, G.A., Horne, W.S. J Am Chem Soc (2013) 135:12528-12531. DOI 10.1021/ja405422v · PubMed

Other PDB entries of the same protein (UniProt P06654 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1IGD 1.1 Å, The third IgG-binding domain from streptococcal protein G: an analysis by X-ray…
2IGD 1.1 Å, Anisotropic structure of protein G IgG-binding domain III at 1.1 Å resolution
3MP9 1.2 Å, Structure of Streptococcal protein G B1 domain at pH 3.0
6CNE 1.2 Å, Selenomethionine variant (V29SeM) of protein GB1
1PGX 1.66 Å, The 1.66 Å X-ray structure of the B2 immunoglobulin-binding domain of streptococcal…
6L9D 1.73 Å, X-ray structure of synthetic GB1 domain with mutations K10(DVA), T11S
6L91 1.84 Å, X-ray structure of synthetic GB1 domain with the mutation K10(DVA).
6LJI 1.84 Å, X-ray structure of synthetic GB1 domain with mutations K10(DVA), T11V
1PGB 1.92 Å, Two crystal structures of the B1 immunoglobulin-binding domain of streptoccocal protein…
4KGS 1.95 Å, Backbone Modifications in the Protein GB1 Loops: beta-3-Val21, beta-3-Asp40
6L9B 1.95 Å, X-ray structure of synthetic GB1 domain with mutations K10(DVA), T11A
1EM7 2.0 Å, Helix variant of the B1 domain from streptococcal protein G

Browse structure collections

About this viewer

MolViewer shows 4KGR directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.