6CNE: Selenomethionine variant (V29SeM) of protein GB1

Selenomethionine variant (V29SeM) of protein GB1. Determined by X-ray diffraction at 1.2 Å resolution. Released 10 Jul 2019.

Method: X-ray diffraction
Resolution: 1.2 Å
Organism: Streptococcus sp. group G
Chains: 2
Atoms: 1,096
Mol. weight: 13.1 kDa
Ligands: PO4
Released: 10 Jul 2019

Explore 6CNE in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6CNE contains 2 α-helices and 8 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A and B: 1 helix, 4 β-strands

Element	Residues	Length	Sheet
β-strand	2-8	7	1
β-strand	13-19	7	1
α-helix	23-36	14
β-strand	42-46	5	1
β-strand	51-55	5	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Immunoglobulin G-binding protein G	A, B	protein	56	Streptococcus sp. group G	P06654 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>6CNE_1 Immunoglobulin G-binding protein G (chains A, B)
GQYKMILNGKTLKGETTTEAVDAATAEKVFKQYANDNGVDGEWTYDDATKTFTVTE

Ligands and cofactors

ID	Name	Formula	Copies
PO4	Phosphate ion	O4 P	2

Water and common crystallization additives (MPD) are not listed.

Primary citation

77Se NMR Probes the Protein Environment of Selenomethionine. Chen, Q., Xu, S., Lu, X. et al. J Phys Chem B (2020) 124:601-616. DOI 10.1021/acs.jpcb.9b07466 · PubMed

Other PDB entries of the same protein (UniProt P06654 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1IGD 1.1 Å, The third IgG-binding domain from streptococcal protein G: an analysis by X-ray…
2IGD 1.1 Å, Anisotropic structure of protein G IgG-binding domain III at 1.1 Å resolution
3MP9 1.2 Å, Structure of Streptococcal protein G B1 domain at pH 3.0
1PGX 1.66 Å, The 1.66 Å X-ray structure of the B2 immunoglobulin-binding domain of streptococcal…
6L9D 1.73 Å, X-ray structure of synthetic GB1 domain with mutations K10(DVA), T11S
6L91 1.84 Å, X-ray structure of synthetic GB1 domain with the mutation K10(DVA).
6LJI 1.84 Å, X-ray structure of synthetic GB1 domain with mutations K10(DVA), T11V
1PGB 1.92 Å, Two crystal structures of the B1 immunoglobulin-binding domain of streptoccocal protein…
4KGS 1.95 Å, Backbone Modifications in the Protein GB1 Loops: beta-3-Val21, beta-3-Asp40
6L9B 1.95 Å, X-ray structure of synthetic GB1 domain with mutations K10(DVA), T11A
1EM7 2.0 Å, Helix variant of the B1 domain from streptococcal protein G
4KGR 2.0 Å, Backbone Modifications in the Protein GB1 Helix: beta-3-Ala24, beta-3-Lys28,…

Browse structure collections

About this viewer

MolViewer shows 6CNE directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.