Type 1 Insulin-like growth factor receptor (DOMAINS 1-3). Determined by X-ray diffraction at 2.6 Å resolution. Released 27 Sept 1999.
Explore 1IGR in 3D Show helices and sheets RCSB PDB PDBe
1IGR contains 13 α-helices and 40 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 2-3 | 2 | 1 |
| β-strand | 7-10 | 4 | 2 |
| α-helix | 13-19 | 7 | |
| β-strand | 24-25 | 2 | 1 |
| β-strand | 29-35 | 7 | 2 |
| β-strand | 50-51 | 2 | 1 |
| β-strand | 55-61 | 7 | 2 |
| α-helix | 66-68 | 3 | |
| β-strand | 75-76 | 2 | 1 |
| β-strand | 82 | 1 | 2 |
| β-strand | 85-90 | 6 | 2 |
| β-strand | 105-106 | 2 | 1 |
| β-strand | 110-114 | 5 | 2 |
| α-helix | 127-130 | 4 | |
| α-helix | 134-136 | 3 | |
| β-strand | 138-140 | 3 | 2 |
| α-helix | 145-148 | 4 | |
| β-strand | 164-166 | 3 | 3 |
| β-strand | 171-173 | 3 | 3 |
| β-strand | 175 | 1 | 4 |
| β-strand | 181 | 1 | 4 |
| α-helix | 182-183 | 2 | |
| α-helix | 187-189 | 3 | |
| β-strand | 194 | 1 | 5 |
| β-strand | 200 | 1 | 5 |
| β-strand | 205-209 | 5 | 6 |
| β-strand | 218-221 | 4 | 6 |
| β-strand | 224-225 | 2 | 7 |
| β-strand | 230-231 | 2 | 7 |
| β-strand | 239-241 | 3 | 7 |
| β-strand | 245-247 | 3 | 7 |
| α-helix | 249-253 | 5 | |
| β-strand | 267-269 | 3 | 7 |
| β-strand | 272-274 | 3 | 7 |
| β-strand | 281-283 | 3 | 8 |
| β-strand | 291-293 | 3 | 8 |
| α-helix | 298-299 | 2 | |
| β-strand | 301-311 | 11 | 9 |
| α-helix | 315-317 | 3 | |
| β-strand | 325-332 | 8 | 9 |
| α-helix | 345-348 | 4 | |
| β-strand | 353-354 | 2 | 9 |
| β-strand | 358-361 | 4 | 9 |
| β-strand | 377-378 | 2 | 9 |
| β-strand | 384 | 1 | 9 |
| β-strand | 388-393 | 6 | 9 |
| β-strand | 410-411 | 2 | 9 |
| β-strand | 415-419 | 5 | 9 |
| β-strand | 421 | 1 | 10 |
| α-helix | 426-436 | 11 | |
| β-strand | 447 | 1 | 9 |
| β-strand | 452 | 1 | 10 |
| α-helix | 474-477 | 4 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Insulin-like growth factor receptor 1 | A | protein | 478 | Homo sapiens | P08069 (AlphaFold model) |
>1IGR_1 INSULIN-LIKE GROWTH FACTOR RECEPTOR 1 (chains A) EICGPGIDIRNDYQQLKRLENCTVIEGYLHILLISKAEDYRSYRFPKLTVITEYLLLFRV AGLESLGDLFPNLTVIRGWKLFYNYALVIFEMTNLKDIGLYNLRNITRGAIRIEKNADLC YLSTVDWSLILDAVSNNYIVGNKPPKECGDLCPGTMEEKPMCEKTTINNEYNYRCWTTNR CQKMCPSTCGKRACTENNECCHPECLGSCSAPDNDTACVACRHYYYAGVCVPACPPNTYR FEGWRCVDRDFCANILSAESSDSEGFVIHDGECMQECPSGFIRNGSQSMYCIPCEGPCPK VCEEEKKTKTIDSVTSAQMLQGCTIFKGNLLINIRRGNNIASELENFMGLIEVVTGYVKI RHSHALVSLSFLKNLRLILGEEQLEGNYSFYVLDNQNLQQLWDWDHRNLTIKAGKMYFAF NPKLCVSEIYRMEEVTGTKGRQSKGDINTRNNGERASCESDVDDDDKEQKLISEEDLN
| ID | Name | Formula | Copies |
|---|---|---|---|
| NAG | 2-acetamido-2-deoxy-beta-D-glucopyranose | C8 H15 N O6 | 2 |
Water and common crystallization additives (SO4) are not listed.
Crystal structure of the first three domains of the type-1 insulin-like growth factor receptor. Garrett, T.P., McKern, N.M., Lou, M. et al. Nature (1998) 394:395-399. DOI 10.1038/28668 · PubMed
Other PDB entries of the same protein (UniProt P08069 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1IGR directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.