1IHJ: N-terminal PDZ domain of InaD

Crystal Structure of the N-terminal PDZ domain of InaD in complex with a NorpA C-terminal peptide. Determined by X-ray diffraction at 1.8 Å resolution. Released 22 Aug 2001.

Method: X-ray diffraction
Resolution: 1.8 Å
Organism: Drosophila melanogaster
Chains: 4
Atoms: 1,685
Mol. weight: 23.05 kDa
Released: 22 Aug 2001

Explore 1IHJ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1IHJ contains 5 α-helices and 14 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	14-21	8	1
β-strand	30-37	8	1
β-strand	45-53	9	1
α-helix	58-62	5
β-strand	70-74	5	1
β-strand	77-78	2	1
α-helix	84-93	10
β-strand	97-104	8	1

Chain B: 3 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	13-21	9	2
β-strand	30-40	11	2
β-strand	43-53	11	2
α-helix	58-62	5
α-helix	69	1
β-strand	70-74	5	2
β-strand	77-78	2	2
α-helix	84-93	10
β-strand	97-105	9	2

Chains C and D: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	6	1	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
InaD	A, B	protein	98	Drosophila melanogaster	Q24008 (AlphaFold model)
phospholipase C	C, D	protein	7

Sequence of entity 1 (A, B), FASTA

>1IHJ_1 InaD (chains A, B)
MAGELIHMVTLDKTGKKSFGICIVRGEVKDSPNTKTTGIFIKGIVPDSPAHLCGRLKVGD
RILSLNGKDVRNSTEQAVIDLIKEADFKIELEIQTFDK

Sequence of entity 2 (C, D), FASTA

>1IHJ_2 phospholipase C (chains C, D)
GKTEFCA

Primary citation

Functional relevance of the disulfide-linked complex of the N-terminal PDZ domain of InaD with NorpA. Kimple, M.E., Siderovski, D.P., Sondek, J. EMBO J (2001) 20:4414-4422. DOI 10.1093/emboj/20.16.4414 · PubMed

Other PDB entries of the same protein (UniProt Q24008 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2QKV 1.55 Å, Crystal Structure of the C645S Mutant of the 5th PDZ Domain of InaD
5F67 1.76 Å, An exquisitely specific PDZ/target recognition revealed by the structure of INAD PDZ3 in…
2QKT 2.05 Å, Crystal Structure of the 5th PDZ domain of InaD
2QKU 2.2 Å, The 5th PDZ Domain of InaD in 10mM DTT
3R0H 2.6 Å, Structure of INAD PDZ45 in complex with NG2 peptide
6IRE 3.25 Å, Complex structure of INAD PDZ45 and NORPA CC-PBM
2LA8 Solution structure of INAD PDZ5 complexed with Kon-tiki peptide

Browse structure collections

About this viewer

MolViewer shows 1IHJ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.