Solution Structure of Human IL-13. Determined by solution NMR. Released 1 May 2002.
Explore 1IK0 in 3D Show helices and sheets RCSB PDB PDBe
1IK0 contains 5 α-helices and 2 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 6-22 | 17 | |
| β-strand | 33-35 | 3 | 1 |
| α-helix | 43-51 | 9 | |
| α-helix | 58-60 | 3 | |
| α-helix | 61-70 | 10 | |
| β-strand | 89-91 | 3 | 1 |
| α-helix | 92-109 | 18 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Interleukin-13 | A | protein | 113 | Homo sapiens | P35225 (AlphaFold model) |
>1IK0_1 INTERLEUKIN-13 (chains A) MGPVPPSTALRELIEELVNITQNQKAPLCNGSMVWSINLTAGMYCAALESLINVSGCSAI EKTQRMLSGFCPHKVSAGQFSSLHVRDTKIEVAQFVKDLLLHLKKLFREGRFN
Solution structure of human IL-13 and implication for receptor binding. Moy, F.J., Diblasio, E., Wilhelm, J. et al. J Mol Biol (2001) 310:219-230. DOI 10.1006/jmbi.2001.4764 · PubMed
Other PDB entries of the same protein (UniProt P35225 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1IK0 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.