3LB6: IL-13

The structure of IL-13 in complex with IL-13Ralpha2. Determined by X-ray diffraction at 3.05 Å resolution. Released 16 Mar 2010.

Method: X-ray diffraction
Resolution: 3.05 Å
Organism: Homo sapiens
Chains: 4
Atoms: 6,088
Mol. weight: 117.72 kDa
Ligands: CA, NAG
Released: 16 Mar 2010

Explore 3LB6 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3LB6 contains 26 α-helices and 55 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 3 β-strands

Element	Residues	Length	Sheet
α-helix	8-22	15
α-helix	28-31	4
β-strand	33-35	3	1
α-helix	44-51	8
α-helix	61-70	10
β-strand	88-91	4	1
α-helix	92-108	17
β-strand	111	1	2

Chain B: 5 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	8-22	15
α-helix	28-31	4
β-strand	33-35	3	9
α-helix	44-51	8
α-helix	61-68	8
β-strand	88-91	4	9
α-helix	92-108	17

Chain C: 9 helices, 23 β-strands

Element	Residues	Length	Sheet
α-helix	33-35	3
β-strand	36-41	6	3
β-strand	48-54	7	3
β-strand	68-75	8	1
β-strand	76	1	4
β-strand	78	1	4
β-strand	82-86	5	1
β-strand	90-94	5	3
β-strand	101-108	8	1
α-helix	111-114	4
β-strand	120	1	1
α-helix	121-123	3
β-strand	124-128	5	1
β-strand	141-148	8	5
β-strand	152-158	7	5
β-strand	169-174	6	6
α-helix	181	1
β-strand	182-183	2	6
α-helix	184	1
β-strand	186-189	4	5
β-strand	194-198	5	5
β-strand	210-216	7	6
α-helix	224-225	2
β-strand	226-230	5	6
α-helix	232-234	3
α-helix	239-241	3
β-strand	242-246	5	7
β-strand	256-259	4	7
β-strand	270-274	5	8
β-strand	287-288	2	8
β-strand	308-312	5	8
α-helix	321-325	5

Chain D: 7 helices, 27 β-strands

Element	Residues	Length	Sheet
α-helix	33-35	3
β-strand	36-41	6	10
β-strand	48-54	7	10
β-strand	68-75	8	9
β-strand	76	1	11
β-strand	78	1	11
α-helix	81	1
β-strand	82-86	5	9
β-strand	90-94	5	10
β-strand	101-109	9	9
α-helix	111-114	4
β-strand	119-120	2	9
α-helix	122-123	2
β-strand	124-128	5	9
β-strand	141-148	8	12
β-strand	152-158	7	12
β-strand	168-174	7	13
β-strand	176	1	14
β-strand	178	1	14
β-strand	182-183	2	13
β-strand	186-189	4	12
β-strand	194-198	5	12
β-strand	210-217	8	13
β-strand	226-230	5	13
α-helix	232-234	3
β-strand	236-237	2	12
α-helix	239-241	3
β-strand	242-245	4	15
β-strand	254-259	6	15
β-strand	270-278	9	2
β-strand	282-288	7	2
β-strand	292-295	4	15
β-strand	304-312	9	2
α-helix	321-325	5

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Interleukin-13	A	protein	132	Homo sapiens	P35225 (AlphaFold model)
Interleukin-13 receptor subunit alpha-2	C	protein	380	Homo sapiens	Q14627 (AlphaFold model)
Interleukin-13	B	protein	132	Homo sapiens	P35225 (AlphaFold model)
Interleukin-13 receptor subunit alpha-2	D	protein	380	Homo sapiens	Q14627 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>3LB6_1 Interleukin-13 (chains A)
MALLLTTVIALTCLGGFASPGPVPPSTALRELIEELVNITQNQKAPLCNGSMVWSINLTA
GMYCAALESLINVSGCSAIEKTQRMLSGFCPHKVSAGQFSSLHVRDTKIEVAQFVKDLLL
HLKKLFREGRFN

Sequence of entity 2 (C), FASTA

>3LB6_2 Interleukin-13 receptor subunit alpha-2 (chains C)
MAFVCLAVGCLYTFLISTTFGCTSSSDTEIKVNPPQDFEIVDPGYLGYLYLQWQPPLSLD
HFKECTVEYELKYRNIGSETWKTIITKNLHYKDGFDLNKGIEAKIHTLLPWQCTNGSEVQ
SSWAETTYWISPQGIPETKVQDMDCVYYNWQYLLCSWKPGIGVLLDTNYNLFYWYEGLDH
ALQCVDYIKADGQNIGCRFPYLEASDYKDFYICVNGSSENKPIRSSYFTFQLQNIVKPLP
PVYLTFTRESSCEIKLKWSIPLGPIPARCFDYEIEIREDDTTLVTATVENETYTLKTTNE
TRQLCFVVRSKVNIYCSDDGIWSEWSDKQCWEGEDLSKKTLLRFWLPFGFILILVIFVTG
LLLRKPNTYPKMIPEFFCDT

Sequence of entity 3 (B), FASTA

>3LB6_3 Interleukin-13 (chains B)
MALLLTTVIALTCLGGFASPGPVPPSTALRELIEELVNITQNQKAPLCNGSMVWSINLTA
GMYCAALESLINVSGCSAIEKTQRMLSGFCPHKVSAGQFSSLHVRDTKIEVAQFVKDLLL
HLKKLFREGRFN

Sequence of entity 4 (D), FASTA

>3LB6_4 Interleukin-13 receptor subunit alpha-2 (chains D)
MAFVCLAVGCLYTFLISTTFGCTSSSDTEIKVNPPQDFEIVDPGYLGYLYLQWQPPLSLD
HFKECTVEYELKYRNIGSETWKTIITKNLHYKDGFDLNKGIEAKIHTLLPWQCTNGSEVQ
SSWAETTYWISPQGIPETKVQDMDCVYYNWQYLLCSWKPGIGVLLDTNYNLFYWYEGLDH
ALQCVDYIKADGQNIGCRFPYLEASDYKDFYICVNGSSENKPIRSSYFTFQLQNIVKPLP
PVYLTFTRESSCEIKLKWSIPLGPIPARCFDYEIEIREDDTTLVTATVENETYTLKTTNE
TRQLCFVVRSKVNIYCSDDGIWSEWSDKQCWEGEDLSKKTLLRFWLPFGFILILVIFVTG
LLLRKPNTYPKMIPEFFCDT

Ligands and cofactors

ID	Name	Formula	Copies
CA	Calcium ion	Ca	2
NAG	2-acetamido-2-deoxy-beta-D-glucopyranose	C8 H15 N O6	2

Primary citation

Molecular basis for shared cytokine recognition revealed in the structure of an unusually high affinity complex between IL-13 and IL-13Ralpha2. Lupardus, P.J., Birnbaum, M.E., Garcia, K.C. Structure (2010) 18:332-342. DOI 10.1016/j.str.2010.01.003 · PubMed

Other PDB entries of the same protein (UniProt P35225 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3L5X 1.9 Å, Crystal structure of the complex between IL-13 and H2L6 FAB
4I77 1.9 Å, Lebrikizumab Fab bound to IL-13
5L6Y 1.99 Å, il13 in complex with tralokinumab
3L5W 2.0 Å, Crystal structure of the complex between IL-13 and C836 FAB
4PS4 2.8 Å, Crystal structure of the complex between IL-13 and M1295 FAB
3BPO 3.0 Å, Crystal structure of the IL13-IL4R-IL13Ra ternary complex
5E4E 3.0 Å, Engineered Interleukin-13 bound to receptor
3G6D 3.2 Å, Crystal structure of the complex between CNTO607 Fab and IL-13
8BLQ 3.97 Å, Cryo-EM structure of the CODV-IL13-RefAb triple complex
1GA3 NMR structure of interleukin-13
1IJZ Solution Structure of Human IL-13
1IK0 Solution Structure of Human IL-13

Browse structure collections

About this viewer

MolViewer shows 3LB6 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.