3L5X: Complex between IL-13 and H2L6 FAB

Crystal structure of the complex between IL-13 and H2L6 FAB. Determined by X-ray diffraction at 1.9 Å resolution. Released 14 Apr 2010.

Method: X-ray diffraction
Resolution: 1.9 Å
Organism: Homo sapiens
Chains: 3
Atoms: 4,498
Mol. weight: 60.38 kDa
Released: 14 Apr 2010

Explore 3L5X in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3L5X contains 25 α-helices and 45 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	8-21	14
β-strand	33-35	3	11
α-helix	44-51	8
α-helix	58-60	3
α-helix	61-70	10
β-strand	89-91	3	11
α-helix	92-109	18

Chain H: 11 helices, 22 β-strands

Element	Residues	Length	Sheet
β-strand	3-6	4	6
α-helix	7-9	3
β-strand	10-12	3	7
α-helix	16-17	2
β-strand	18-25	8	6
β-strand	35-41	7	7
β-strand	48-54	7	7
β-strand	59-61	3	7
α-helix	66-68	3
β-strand	69-74	6	6
α-helix	75-77	3
β-strand	79-84	6	6
α-helix	89-91	3
β-strand	93-100	8	7
β-strand	108-111	4	7
β-strand	115-119	5	7
α-helix	122-124	3
β-strand	125	1	8
α-helix	126-127	2
β-strand	128-132	5	9
β-strand	143-153	11	9
β-strand	154	1	8
β-strand	159-162	4	10
α-helix	163-165	3
β-strand	167	1	10
β-strand	171-173	3	9
α-helix	174-176	3
β-strand	177-178	2	9
β-strand	184-193	10	9
α-helix	196-199	4
β-strand	203-208	6	10
α-helix	209-211	3
β-strand	213-218	6	10

Chain L: 9 helices, 21 β-strands

Element	Residues	Length	Sheet
β-strand	4-7	4	1
β-strand	10-13	4	2
β-strand	19-25	7	1
β-strand	33-38	6	2
β-strand	45-49	5	2
β-strand	53-54	2	2
α-helix	55	1
β-strand	62-67	6	1
β-strand	70-75	6	1
α-helix	80-82	3
β-strand	85-90	6	2
α-helix	96	1
β-strand	97-98	2	2
β-strand	102-106	5	2
β-strand	111	1	3
α-helix	112-113	2
β-strand	114-118	5	4
α-helix	119-121	3
α-helix	122-125	4
β-strand	129-139	11	4
β-strand	140	1	3
β-strand	145-150	6	5
β-strand	153-154	2	5
α-helix	155	1
β-strand	159-163	5	4
α-helix	164-167	4
β-strand	173-182	10	4
α-helix	183-186	4
β-strand	191-197	7	5
β-strand	205-210	6	5

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
H2L6 light chain	L	protein	214	Homo sapiens
H2L6 heavy chain	H	protein	224	Homo sapiens
Interleukin-13	A	protein	113	Homo sapiens	P35225 (AlphaFold model)

Sequence of entity 1 (L), FASTA

>3L5X_1 H2L6 LIGHT CHAIN (chains L)
EIVLTQSPATLSLSPGERATLSCRASKSISKYLAWYQQKPGQAPRLLIYSGSTLQSGIPA
RFSGSGSGTDFTLTISSLEPEDFAVYYCQQHNEYPYTFGQGTKLEIKRTVAAPSVFIFPP
SDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLT
LSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC

Sequence of entity 2 (H), FASTA

>3L5X_2 H2L6 HEAVY CHAIN (chains H)
QVTLKESGPVLVKPTETLTLTCTVSGFSLSTYGMGVGWIRQPPGKALEWLAHIWWDDVKR
YNPALKSRLTISKDTSKSQVVLTMTNMDPVDTATYYCARMGSDYDVWFDYWGQGTLVTVS
SASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQS
SGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSC

Sequence of entity 3 (A), FASTA

>3L5X_3 Interleukin-13 (chains A)
MGPVPPSTALRELIEELVNITQNQKAPLCNGSMVWSINLTAGMYCAALESLINVSGCSAI
EKTQRMLSGFCPHKVSAGQFSSLHVRDTKIEVAQFVKDLLLHLKKLFREGRFN

Primary citation

Human framework adaptation of a mouse anti-human IL-13 antibody. Fransson, J., Teplyakov, A., Raghunathan, G. et al. J Mol Biol (2010) 398:214-231. DOI 10.1016/j.jmb.2010.03.004 · PubMed

Other PDB entries of the same protein (UniProt P35225 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4I77 1.9 Å, Lebrikizumab Fab bound to IL-13
5L6Y 1.99 Å, il13 in complex with tralokinumab
3L5W 2.0 Å, Crystal structure of the complex between IL-13 and C836 FAB
4PS4 2.8 Å, Crystal structure of the complex between IL-13 and M1295 FAB
3BPO 3.0 Å, Crystal structure of the IL13-IL4R-IL13Ra ternary complex
5E4E 3.0 Å, Engineered Interleukin-13 bound to receptor
3LB6 3.05 Å, The structure of IL-13 in complex with IL-13Ralpha2
3G6D 3.2 Å, Crystal structure of the complex between CNTO607 Fab and IL-13
8BLQ 3.97 Å, Cryo-EM structure of the CODV-IL13-RefAb triple complex
1GA3 NMR structure of interleukin-13
1IJZ Solution Structure of Human IL-13
1IK0 Solution Structure of Human IL-13

Browse structure collections

About this viewer

MolViewer shows 3L5X directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.