1IQD: Human monoclonal BO2C11 FAB light chain

Human Factor VIII C2 Domain complexed to human monoclonal BO2C11 Fab. Determined by X-ray diffraction at 2.0 Å resolution. Released 15 Aug 2001.

Method: X-ray diffraction
Resolution: 2.0 Å
Organism: Homo sapiens
Chains: 3
Atoms: 4,812
Mol. weight: 63.4 kDa
Released: 15 Aug 2001

Explore 1IQD in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1IQD contains 18 α-helices and 59 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 9 helices, 20 β-strands

Element	Residues	Length	Sheet
β-strand	4-7	4	1
β-strand	10-13	4	2
β-strand	19-29	11	1
α-helix	31-33	3
β-strand	34-39	6	2
β-strand	46-50	5	2
β-strand	54-55	2	2
α-helix	56	1
β-strand	63-76	14	1
α-helix	81-83	3
β-strand	86-91	6	2
β-strand	98-99	2	2
β-strand	103-107	5	2
β-strand	112	1	3
α-helix	113-114	2
β-strand	115-119	5	4
α-helix	120-122	3
α-helix	123-126	4
β-strand	130-140	11	4
β-strand	141	1	3
β-strand	146-151	6	5
β-strand	154-155	2	5
α-helix	156	1
β-strand	160-164	5	4
α-helix	165-168	4
β-strand	174-183	10	4
α-helix	184-187	4
β-strand	192-198	7	5
β-strand	207-211	5	5

Chain B: 7 helices, 22 β-strands

Element	Residues	Length	Sheet
β-strand	3-6	4	6
α-helix	7-9	3
β-strand	10-12	3	7
β-strand	18-25	8	6
α-helix	29-31	3
β-strand	34-39	6	7
β-strand	45-52	8	7
β-strand	57-60	4	7
α-helix	62-64	3
β-strand	68-73	6	6
β-strand	78-83	6	6
α-helix	85-87	3
β-strand	89-95	7	7
β-strand	103-104	2	7
β-strand	108-112	5	7
β-strand	118	1	8
β-strand	121-125	5	9
β-strand	138-146	9	9
β-strand	147	1	8
β-strand	152-155	4	10
α-helix	156-158	3
β-strand	160	1	10
β-strand	164-166	3	9
α-helix	167-169	3
β-strand	170-171	2	9
β-strand	177-184	8	9
β-strand	196-201	6	10
α-helix	202-204	3
β-strand	206-211	6	10

Chain C: 2 helices, 17 β-strands

Element	Residues	Length	Sheet
β-strand	2176-2177	2	11
α-helix	2187-2189	3
β-strand	2190-2192	3	11
β-strand	2197-2198	2	12
β-strand	2201-2202	2	12
α-helix	2205-2207	3
β-strand	2209	1	11
β-strand	2219	1	13
β-strand	2230-2246	17	11
β-strand	2248-2249	2	14
β-strand	2254-2255	2	14
β-strand	2256-2265	10	11
β-strand	2272-2273	2	11
β-strand	2275-2276	2	15
β-strand	2279-2280	2	15
β-strand	2283-2284	2	11
β-strand	2293-2314	22	11
β-strand	2319	1	13
β-strand	2320-2327	8	11

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Human monoclonal BO2C11 FAB light chain	A	protein	211	Homo sapiens
Human monoclonal BO2C11 FAB heavy chain	B	protein	215	Homo sapiens
Human factor VIII	C	protein	156	Homo sapiens	P00451 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1IQD_1 HUMAN MONOCLONAL BO2C11 FAB LIGHT CHAIN (chains A)
IALTQSPGTLSLSPGERATLSCRASQSFSSSYLAWYQQKPGQAPRLLIYGASTRATGIPD
RFSGSGSGTDFTLTISRLEPEDFAVYYCQKYGTSAITFGQGTRLEIKGTVAAPSVFIFPP
SDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLT
LSKADYEKHKVYACEVTHQGLSSPVTKSFNR

Sequence of entity 2 (B), FASTA

>1IQD_2 HUMAN MONOCLONAL BO2C11 FAB HEAVY CHAIN (chains B)
QVQLVQSGAEVKKPGASVKVSCKVSGYTLTELPVHWVRQAPGKGLEWVGSFDPESGESIY
AREFQGSVTMTADTSTNIAYMELSSLRSDDTAVYYCAVPDPDAFDIWGQGTMVTVSSAST
KGPSVFPLAPCSRSTSESTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLY
SLSSVVTVPSSSLGTATYTCNVDHKPSNTKVDKRV

Sequence of entity 3 (C), FASTA

>1IQD_3 HUMAN FACTOR VIII (chains C)
CSMPLGMESKAISDAQITASSYFTNMFATWSPSKARLHLQGRSNAWRPQVNNPKEWLQVD
FQKTMKVTGVTTQGVKSLLTSMYVKEFLISSSQDGHQWTLFFQNGKVKVFQGNQDSFTPV
VNCLDPPLLTRYLRIHPQSWVHQIALRMEVLGCEAQ

Primary citation

Structure of a factor VIII C2 domain-immunoglobulin G4kappa Fab complex: identification of an inhibitory antibody epitope on the surface of factor VIII. Spiegel Jr., P.C., Jacquemin, M., Saint-Remy, J.M. et al. Blood (2001) 98:13-19. DOI 10.1182/blood.V98.1.13 · PubMed

Other PDB entries of the same protein (UniProt P00451 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3HNY 1.07 Å, Factor VIII Trp2313-His2315 segment is involved in membrane binding as shown by crystal…
3HNB 1.15 Å, Factor VIII Trp2313-His2315 segment is involved in membrane binding as shown by crystal…
1D7P 1.5 Å, Crystal structure of the c2 domain of human factor viii at 1.5 a resolution at 1.5 A
9D5D 1.83 Å, Crystal Structure of Blood Coagulation Factor VIII C2 Domain Mutant L2251A/L2252A
3HOB 2.07 Å, Factor VIII Trp2313-His2315 segment is involved in membrane binding as shown by crystal…
4PT6 2.1 Å, The discobody: an engineered discoidin domain from factor VIII that binds v 3 integrin…
4KI5 2.47 Å, Cystal structure of human factor VIII C2 domain in a ternary complex with murine…
4XZU 2.61 Å, Crystal Structure of the Human Factor VIII C2 Domain in Complex with Murine 3E6…
7KWO 2.9 Å, Rfviiifc-vwf-xten (BIVV001)
36JL 3.15 Å, Coagulation factor VIII, full-length, membrane-bound, on Ptd-choline : Ptd-serine 75:25…
9JBV 3.17 Å, Structure of Engineered Coagulation Factor VIII with Enhanced Secretion and Coagulation…
6MF0 3.2 Å, Crystal Structure Determination of Human/Porcine Chimera Coagulation Factor VIII

Browse structure collections

About this viewer

MolViewer shows 1IQD directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.