Interferon alpha-2A, NMR, 24 structures. Determined by solution NMR. Released 3 Dec 1997.
Explore 1ITF in 3D Show helices and sheets RCSB PDB PDBe
1ITF contains 7 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 10-21 | 12 | |
| α-helix | 40-43 | 4 | |
| α-helix | 53-68 | 16 | |
| α-helix | 70-75 | 6 | |
| α-helix | 78-100 | 23 | |
| α-helix | 111-132 | 22 | |
| α-helix | 137-155 | 19 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Interferon alpha-2A | A | protein | 165 | Homo sapiens | P01563 (AlphaFold model) |
>1ITF_1 INTERFERON ALPHA-2A (chains A) CDLPQTHSLGSRRTLMLLAQMRKISLFSCLKDRHDFGFPQEEFGNQFQKAETIPVLHEMI QQIFNLFSTKDSSAAWDETLLDKFYTELYQQLNDLEACVIQGVGVTETPLMKEDSILAVR KYFQRITLYLKEKKYSPCAWEVVRAEIMRSFSLSTNLQESLRSKE
The three-dimensional high resolution structure of human interferon alpha-2a determined by heteronuclear NMR spectroscopy in solution. Klaus, W., Gsell, B., Labhardt, A.M. et al. J Mol Biol (1997) 274:661-675. DOI 10.1006/jmbi.1997.1396 · PubMed
Other PDB entries of the same protein (UniProt P01563 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1ITF directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.