1IZN: Actin Filament Capping Protein CapZ

Crystal Structure of Actin Filament Capping Protein CapZ. Determined by X-ray diffraction at 2.1 Å resolution. Released 8 Apr 2003.

Method: X-ray diffraction
Resolution: 2.1 Å
Organism: Gallus gallus
Chains: 4
Atoms: 9,272
Mol. weight: 129.06 kDa
Released: 8 Apr 2003

Explore 1IZN in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1IZN contains 48 α-helices and 42 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 11 helices, 11 β-strands

Element	Residues	Length	Sheet
α-helix	10-22	13
α-helix	24-25	2
α-helix	29-40	12
α-helix	43-60	18
β-strand	63-65	3	1
β-strand	74-76	3	1
β-strand	81	1	2
β-strand	86-88	3	2
β-strand	94-97	4	2
α-helix	98-99	2
β-strand	109-110	2	2
α-helix	118-135	18
β-strand	139-148	10	3
β-strand	151-164	14	3
α-helix	165-167	3
β-strand	169-180	12	3
β-strand	185-198	14	3
β-strand	202-217	16	3
α-helix	222-249	28
α-helix	250-254	5
α-helix	255-258	4
α-helix	271-274	4

Chain B: 13 helices, 10 β-strands

Element	Residues	Length	Sheet
α-helix	3-13	11
α-helix	18-20	3
α-helix	21-31	11
α-helix	33-35	3
α-helix	36-42	7
α-helix	47	1
β-strand	48-52	5	4
β-strand	57-61	5	4
α-helix	63-65	3
β-strand	66-67	2	5
β-strand	70-72	3	5
β-strand	79-80	2	5
α-helix	91-112	22
β-strand	116-123	8	3
β-strand	127-137	11	3
β-strand	144-158	15	3
β-strand	164-181	18	3
α-helix	182-184	3
β-strand	185-202	18	3
α-helix	209-230	22
α-helix	231-235	5
α-helix	236-243	8
α-helix	253-267	15

Chain C: 11 helices, 11 β-strands

Element	Residues	Length	Sheet
α-helix	10-22	13
α-helix	24-25	2
α-helix	29-40	12
α-helix	43-60	18
β-strand	63-65	3	6
β-strand	74-76	3	6
α-helix	78-80	3
β-strand	81	1	7
β-strand	86-87	2	7
β-strand	95-98	4	7
β-strand	105-109	5	7
α-helix	118-135	18
β-strand	139-148	10	8
β-strand	151-164	14	8
α-helix	165-167	3
β-strand	169-182	14	8
β-strand	185-198	14	8
β-strand	202-217	16	8
α-helix	222-249	28
α-helix	250-254	5
α-helix	255-257	3
α-helix	271-275	5

Chain D: 13 helices, 10 β-strands

Element	Residues	Length	Sheet
α-helix	3-13	11
α-helix	18-20	3
α-helix	21-31	11
α-helix	33-35	3
α-helix	36-42	7
α-helix	46-47	2
β-strand	48-52	5	9
β-strand	57-61	5	9
α-helix	63-65	3
β-strand	66-67	2	10
β-strand	70-72	3	10
β-strand	79-80	2	10
α-helix	91-112	22
β-strand	116-124	9	8
β-strand	127-137	11	8
β-strand	144-158	15	8
β-strand	164-181	18	8
β-strand	185-202	18	8
α-helix	209-230	22
α-helix	231-235	5
α-helix	236-243	8
α-helix	248-251	4
α-helix	254-267	14

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
CapZ alpha-1 subunit	A, C	protein	286	Gallus gallus	P13127 (AlphaFold model)
CapZ beta-1 subunit	B, D	protein	277	Gallus gallus	P14315 (AlphaFold model)

Sequence of entity 1 (A, C), FASTA

>1IZN_1 CapZ alpha-1 subunit (chains A, C)
MADFEDRVSDEEKVRIAAKFITHAPPGEFNEVFNDVRLLLNNDNLLREGAAHAFAQYNMD
QFTPVKIEGYDDQVLITEHGDLGNGRFLDPRNKISFKFDHLRKEASDPQPEDTESALKQW
RDACDSALRAYVKDHYPNGFCTVYGKSIDGQQTIIACIESHQFQPKNFWNGRWRSEWKFT
ITPPTAQVAAVLKIQVHYYEDGNVQLVSHKDIQDSVQVSSDVQTAKEFIKIIENAENEYQ
TAISENYQTMSDTTFKALRRQLPVTRTKIDWNKILSYKIGKEMQNA

Sequence of entity 2 (B, D), FASTA

>1IZN_2 CapZ beta-1 subunit (chains B, D)
MSDQQLDCALDLMRRLPPQQIEKNLSDLIDLVPSLCEDLLSSVDQPLKIARDKVVGKDYL
LCDYNRDGDSYRSPWSNKYDPPLEDGAMPSARLRKLEVEANNAFDQYRDLYFEGGVSSVY
LWDLDHGFAGVILIKKAGDGSKKIKGCWDSIHVVEVQEKSSGRTAHYKLTSTVMLWLQTN
KTGSGTMNLGGSLTRQMEKDETVSDSSPHIANIGRLVEDMENKIRSTLNEIYFGKTKDIV
NGLRSIDAIPDNQKYKQLQRELSQVLTQRQIYIQPDN

Primary citation

Crystal structure of CapZ: structural basis for actin filament barbed end capping. Yamashita, A., Maeda, K., Maeda, Y. EMBO J (2003) 22:1529-1538. DOI 10.1093/emboj/cdg167 · PubMed

Other PDB entries of the same protein (UniProt P13127 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7DS6 1.69 Å, Crystal structure of actin capping protein in complex with twinflin-1/CD2AP CPI chimera…
3AA0 1.7 Å, Crystal structure of Actin Capping Protein in complex with the Cp-binding motif derived…
7DS4 1.85 Å, Crystal structure of actin capping protein in complex with twinflin-1 C-terminus tail…
3AA1 1.9 Å, Crystal structure of Actin capping protein in complex with the Cp-binding motif derived…
3AA6 1.9 Å, Crystal structure of Actin capping protein in complex with the Cp-binding motif derived…
3AA7 1.9 Å, Crystal structure of Actin capping protein
7DS2 1.95 Å, Crystal structure of actin capping protein in complex with twinflin-1 C-terminus tail
7DS8 1.95 Å, Crystal structure of actin capping protein in complex with twinflin-1/CD2AP CPI chimera…
3LK4 1.99 Å, Crystal structure of CapZ bound to the uncapping motif from CD2AP
9BLI 2.0 Å, Crystal structure of Actin capping protein in complex with a fragment of Legionella…
7DS3 2.09 Å, Crystal structure of actin capping protein in complex with twinflin-2 C-terminus tail
3AAA 2.2 Å, Crystal Structure of Actin capping protein in complex with V-1

Browse structure collections

About this viewer

MolViewer shows 1IZN directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.