1J1D: Troponin C

Crystal structure of the 46kDa domain of human cardiac troponin in the Ca2+ saturated form. Determined by X-ray diffraction at 2.61 Å resolution. Released 15 Jul 2003.

Method: X-ray diffraction
Resolution: 2.61 Å
Organism: Homo sapiens
Chains: 6
Atoms: 5,777
Mol. weight: 93.11 kDa
Ligands: CA
Released: 15 Jul 2003

Explore 1J1D in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1J1D contains 30 α-helices and 8 β-strands across 6 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 9 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	6-10	5
α-helix	14-27	14
β-strand	36	1	1
α-helix	38-47	10
α-helix	54-62	9
β-strand	72	1	1
α-helix	74-83	10
α-helix	94-104	11
β-strand	112-113	2	2
α-helix	114-123	10
α-helix	130-140	11
β-strand	147-148	2	2
α-helix	150-157	8

Chain B: 2 helices, 0 β-strands

Element	Residues	Length	Sheet
α-helix	204-221	18
α-helix	226-269	44

Chain C: 4 helices, 0 β-strands

Element	Residues	Length
α-helix	43-79	37
α-helix	81-83	3
α-helix	90-135	46
α-helix	151-158	8

Chain D: 9 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	4-10	7
α-helix	14-27	14
β-strand	36	1	3
α-helix	38-49	12
α-helix	54-64	11
β-strand	72	1	3
α-helix	74-84	11
α-helix	94-104	11
β-strand	111-113	3	4
α-helix	114-122	9
α-helix	130-140	11
β-strand	147-149	3	4
α-helix	150-156	7

Chain E: 2 helices, 0 β-strands

Element	Residues	Length	Sheet
α-helix	202-221	20
α-helix	226-270	45

Chain F: 4 helices, 0 β-strands

Element	Residues	Length
α-helix	43-79	37
α-helix	90-136	47
α-helix	151-158	8
α-helix	159-161	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Troponin C	A, D	protein	161	Homo sapiens	P63316 (AlphaFold model)
Troponin T	B, E	protein	106	Homo sapiens	P45379 (AlphaFold model)
Troponin I	C, F	protein	133	Homo sapiens	P19429 (AlphaFold model)

Sequence of entity 1 (A, D), FASTA

>1J1D_1 Troponin C (chains A, D)
MDDIYKAAVEQLTEEQKNEFKAAFDIFVLGAEDGSISTKELGKVMRMLGQNPTPEELQEM
IDEVDEDGSGTVDFDEFLVMMVRSMKDDSKGKSEEELSDLFRMFDKNADGYIDLEELKIM
LQATGETITEDDIEELMKDGDKNNDGRIDYDEFLEFMKGVE

Sequence of entity 2 (B, E), FASTA

>1J1D_2 Troponin T (chains B, E)
HFGGYIQKQAQTERKSGKRQTEREKKKKILAERRKVLAIDHLNEDQLREKAKELWQTIYN
LEAEKFDLQEKFKQQKYEINVLRNRINDNQKVSKTRGKAKVTGRWK

Sequence of entity 3 (C, F), FASTA

>1J1D_3 Troponin I (chains C, F)
MEPHAKKKSKISASRKLQLKTLLLQIAKQELEREAEERRGEKGRALSTRAQPLELAGLGF
AELQDLARQLHARVDKVDEERYDIEAKVTKNITEIADLTQKIFDLRGKFKRPTLRRVRIS
ADAMMQALLGARA

Ligands and cofactors

ID	Name	Formula	Copies
CA	Calcium ion	Ca	6

Primary citation

Structure of the core domain of human cardiac troponin in the Ca2+-saturated form. Takeda, S., Yamashita, A., Maeda, K. et al. Nature (2003) 424:35-41. DOI 10.1038/nature01780 · PubMed

Other PDB entries of the same protein (UniProt P63316 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3SD6 1.37 Å, Crystal structure of the amino-terminal domain of human cardiac troponin C in complex…
4GJE 1.6 Å, Crystal structure of the refolded amino-terminal domain of human cardiac troponin C in…
3SWB 1.67 Å, Crystal structure of the amino-terminal domain of human cardiac troponin C in complex…
7SC2 1.81 Å, Crystal structure of the N-domain of cardiac muscle troponin C tethered to the switch…
4GJF 1.9 Å, Crystal structure of the amino-terminal domain of human cardiac troponin C mutant L29Q…
4GJG 2.0 Å, Crystal structure of the amino-terminal domain of human cardiac troponin C mutant…
4Y99 2.0 Å, Core domain of human cardiac troponin
1WRK 2.15 Å, Crystal structure of the N-terminal domain of human cardiac troponin C in complex with…
3RV5 2.2 Å, Crystal structure of human cardiac troponin C regulatory domain in complex with cadmium…
7SC3 2.23 Å, Crystal structure of the N-domain of cardiac muscle troponin C tethered to the switch…
1WRL 2.6 Å, Crystal structure of the N-terminal domain of human cardiac troponin C in complex with…
8FMO 2.61 Å, Complex structure of K210 deletion Troponin complex with risedronate

Browse structure collections

About this viewer

MolViewer shows 1J1D directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.