1J2F: IRF-3 and its functional implications

X-ray crystal structure of IRF-3 and its functional implications. Determined by X-ray diffraction at 2.3 Å resolution. Released 25 Nov 2003.

Method: X-ray diffraction
Resolution: 2.3 Å
Organism: Homo sapiens
Chains: 2
Atoms: 3,728
Mol. weight: 56.76 kDa
Released: 25 Nov 2003

Explore 1J2F in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1J2F contains 22 α-helices and 30 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 11 helices, 15 β-strands

Element	Residues	Length	Sheet
α-helix	191-195	5
α-helix	201	1
β-strand	202	1	1
β-strand	203-210	8	2
β-strand	213-221	9	2
β-strand	226-229	4	3
β-strand	241-244	4	3
α-helix	245-247	3
α-helix	248-250	3
α-helix	255-267	13
β-strand	272-277	6	3
β-strand	280-285	6	3
β-strand	291-296	6	2
α-helix	300-302	3
β-strand	309-310	2	2
β-strand	317-321	5	3
α-helix	322-333	12
α-helix	338-341	4
β-strand	343-348	6	2
α-helix	357-360	4
β-strand	363-369	7	2
α-helix	370-380	11
β-strand	388-391	4	4
β-strand	395	1	1
β-strand	401-404	4	4
α-helix	405-416	12

Chain B: 11 helices, 15 β-strands

Element	Residues	Length	Sheet
α-helix	191-195	5
α-helix	201	1
β-strand	202	1	5
β-strand	203-210	8	6
β-strand	213-221	9	6
β-strand	226-229	4	7
β-strand	241-244	4	7
α-helix	245-247	3
α-helix	255-267	13
β-strand	272-277	6	7
β-strand	280-285	6	7
β-strand	291-296	6	6
α-helix	300-301	2
β-strand	309-310	2	6
β-strand	317-321	5	7
α-helix	322-333	12
α-helix	339-341	3
β-strand	343-348	6	6
α-helix	357-360	4
β-strand	363-369	7	6
α-helix	370-382	13
α-helix	388	1
β-strand	389-391	3	8
β-strand	395	1	5
β-strand	401-403	3	8
α-helix	405-417	13

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Interferon regulatory factor 3	A, B	protein	258	Homo sapiens	Q14653 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>1J2F_1 Interferon regulatory factor 3 (chains A, B)
GAMGSSLDNPTPFPNLGPSENPLKRLLVPGEEWEFEVTAFYRGRQVFQQTISCPEGLRLV
GSEVGDRTLPGWPVTLPDPGMSLTDRGVMSYVRHVLSCLGGGLALWRAGQWLWAQRLGHC
HTYWAVSEELLPNSGHGPDGEVPKDKEGGVFDLGPFIVDLITFTEGSGRSPRYALWFCVG
ESWPQDQPWTKRLVMVKVVPTCLRALVEMARVGGASSLENTVDLHISNSHPLSLTSDQYK
AYLQDLVEGMDFQGPGES

Primary citation

X-ray crystal structure of IRF-3 and its functional implications. Takahasi, K., Suzuki, N.N., Horiuchi, M. et al. Nat Struct Biol (2003) 10:922-927. DOI 10.1038/nsb1001 · PubMed

Other PDB entries of the same protein (UniProt Q14653 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6SJA 1.5 Å, Structure of HPV16 E6 oncoprotein in complex with IRF3 LxxLL motif
5JEL 1.6 Å, Phosphorylated TRIF in complex with IRF-3
7JFL 1.68 Å, Crystal structure of human phosphorylated IRF-3 bound to CBP
5JEO 1.72 Å, Phosphorylated Rotavirus NSP1 in complex with IRF-3
6SIV 1.75 Å, Structure of HPV16 E6 oncoprotein in complex with mutant IRF3 LxxLL motif
3A77 1.8 Å, The crystal structure of phosphorylated IRF-3
5JEJ 2.0 Å, Phosphorylated STING in complex with IRF-3 CTD
1QWT 2.1 Å, Auto-inhibitory interferon regulation factor-3 (IRF3) transactivation domain
3QU6 2.3 Å, Crystal structure of IRF-3 DBD free form
2PI0 2.31 Å, Crystal Structure of IRF-3 bound to the PRDIII-I regulatory element of the human…
1ZOQ 2.37 Å, IRF3-CBP complex
5JEK 2.4 Å, Phosphorylated MAVS in complex with IRF-3

Browse structure collections

About this viewer

MolViewer shows 1J2F directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.