2PI0: IRF-3

Crystal Structure of IRF-3 bound to the PRDIII-I regulatory element of the human interferon-B enhancer. Determined by X-ray diffraction at 2.31 Å resolution. Released 30 Oct 2007.

Method: X-ray diffraction
Resolution: 2.31 Å
Organism: Homo sapiens
Chains: 6
Atoms: 4,790
Mol. weight: 73.27 kDa
Released: 30 Oct 2007

Explore 2PI0 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2PI0 contains 17 α-helices and 24 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	8-18	11
β-strand	25-26	2	1
β-strand	33-37	5	1
α-helix	53-60	8
β-strand	66	1	2
β-strand	69	1	2
α-helix	73-86	14
β-strand	91-96	6	1
β-strand	104-108	5	1

Chain B: 5 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	3-7	5
α-helix	8-18	11
β-strand	25-26	2	3
β-strand	33-37	5	3
α-helix	49-51	3
α-helix	52-60	9
β-strand	66	1	4
β-strand	69	1	4
α-helix	73-85	13
β-strand	90-96	7	3
β-strand	104-109	6	3

Chain C: 5 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	5-7	3
α-helix	8-18	11
β-strand	25-26	2	5
β-strand	33-37	5	5
α-helix	49-51	3
α-helix	52-60	9
β-strand	66	1	6
β-strand	69	1	6
α-helix	73-84	12
β-strand	90-96	7	5
β-strand	104-109	6	5

Chain D: 4 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	5-7	3
α-helix	8-18	11
β-strand	25-26	2	7
β-strand	33-37	5	7
α-helix	53-60	8
β-strand	66	1	8
β-strand	69	1	8
α-helix	73-85	13
β-strand	90-96	7	7
β-strand	104-109	6	7

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
PRDIII-I region of human interferon-B promoter strand 1	E	DNA	32
PRDIII-I region of human interferon-B promoter strand 2	F	DNA	32
Interferon regulatory factor 3	A, B, C, D	protein	116	Homo sapiens	Q14653 (AlphaFold model)

Sequence of entity 1 (E), FASTA

>2PI0_1 PRDIII-I region of human interferon-B promoter strand 1 (chains E)
CATAGGAAAACTGAAAGGGAGAAGTGAAAGTG

Sequence of entity 2 (F), FASTA

>2PI0_2 PRDIII-I region of human interferon-B promoter strand 2 (chains F)
CACTTTCACTTCTCCCTTTCAGTTTTCCTATG

Sequence of entity 3 (A, B, C, D), FASTA

>2PI0_3 Interferon regulatory factor 3 (chains A, B, C, D)
GSHMGTPKPRILPWLVSQLDLGQLEGVAWVNKSRTRFRIPWKHGLRQDAQQEDFGIFQAW
AEATGAYVPGRDKPDLPTWKRNFRSALNRKEGLRLAEDRSKDPHDPHKIYEFVNSG

Primary citation

Structure of IRF-3 bound to the PRDIII-I regulatory element of the human interferon-beta enhancer. Escalante, C.R., Nistal-Villan, E., Shen, L. et al. Mol Cell (2007) 26:703-716. DOI 10.1016/j.molcel.2007.04.022 · PubMed

Other PDB entries of the same protein (UniProt Q14653 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6SJA 1.5 Å, Structure of HPV16 E6 oncoprotein in complex with IRF3 LxxLL motif
5JEL 1.6 Å, Phosphorylated TRIF in complex with IRF-3
7JFL 1.68 Å, Crystal structure of human phosphorylated IRF-3 bound to CBP
5JEO 1.72 Å, Phosphorylated Rotavirus NSP1 in complex with IRF-3
6SIV 1.75 Å, Structure of HPV16 E6 oncoprotein in complex with mutant IRF3 LxxLL motif
3A77 1.8 Å, The crystal structure of phosphorylated IRF-3
5JEJ 2.0 Å, Phosphorylated STING in complex with IRF-3 CTD
1QWT 2.1 Å, Auto-inhibitory interferon regulation factor-3 (IRF3) transactivation domain
1J2F 2.3 Å, X-ray crystal structure of IRF-3 and its functional implications
3QU6 2.3 Å, Crystal structure of IRF-3 DBD free form
1ZOQ 2.37 Å, IRF3-CBP complex
5JEK 2.4 Å, Phosphorylated MAVS in complex with IRF-3

Browse structure collections

About this viewer

MolViewer shows 2PI0 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.