3QU6: IRF-3 DBD free form

Crystal structure of IRF-3 DBD free form. Determined by X-ray diffraction at 2.3 Å resolution. Released 1 Jun 2011.

Method: X-ray diffraction
Resolution: 2.3 Å
Organism: Homo sapiens
Chains: 3
Atoms: 2,550
Mol. weight: 41.15 kDa
Ligands: ZN
Released: 1 Jun 2011

Explore 3QU6 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3QU6 contains 10 α-helices and 16 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	8-18	11
β-strand	25-26	2	1
β-strand	33-37	5	1
α-helix	53-60	8
β-strand	66	1	2
β-strand	69	1	2
α-helix	73-85	13
β-strand	90-96	7	1
β-strand	104-109	6	1

Chain B: 4 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	8-18	11
β-strand	25-26	2	3
β-strand	33-37	5	3
α-helix	53-60	8
β-strand	66	1	4
β-strand	69	1	4
α-helix	70-71	2
α-helix	73-85	13
β-strand	90-95	6	3
β-strand	104-109	6	3

Chain C: 3 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	8-18	11
β-strand	25-26	2	5
β-strand	33-37	5	5
α-helix	53-60	8
α-helix	73-85	13
β-strand	90-95	6	5
β-strand	104-109	6	5

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
IRF3 protein	A, B, C	protein	116	Homo sapiens	Q14653 (AlphaFold model)

Sequence of entity 1 (A, B, C), FASTA

>3QU6_1 IRF3 protein (chains A, B, C)
GSHMGTPKPRILPWLVSQLDLGQLEGVAWVNKSRTRFRIPWKHGLRQDAQQEDFGIFQAW
AEATGAYVPGRDKPDLPTWKRNFRSAMNRKEGLRLAEDRSKDPHDPHKIYEFVNSG

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	9

Water and common crystallization additives (CL, NA) are not listed.

Primary citation

Structures of apo IRF-3 and IRF-7 DNA binding domains: effect of loop L1 on DNA binding. De Ioannes, P., Escalante, C.R., Aggarwal, A.K. Nucleic Acids Res (2011) 39:7300-7307. DOI 10.1093/nar/gkr325 · PubMed

Other PDB entries of the same protein (UniProt Q14653 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6SJA 1.5 Å, Structure of HPV16 E6 oncoprotein in complex with IRF3 LxxLL motif
5JEL 1.6 Å, Phosphorylated TRIF in complex with IRF-3
7JFL 1.68 Å, Crystal structure of human phosphorylated IRF-3 bound to CBP
5JEO 1.72 Å, Phosphorylated Rotavirus NSP1 in complex with IRF-3
6SIV 1.75 Å, Structure of HPV16 E6 oncoprotein in complex with mutant IRF3 LxxLL motif
3A77 1.8 Å, The crystal structure of phosphorylated IRF-3
5JEJ 2.0 Å, Phosphorylated STING in complex with IRF-3 CTD
1QWT 2.1 Å, Auto-inhibitory interferon regulation factor-3 (IRF3) transactivation domain
1J2F 2.3 Å, X-ray crystal structure of IRF-3 and its functional implications
2PI0 2.31 Å, Crystal Structure of IRF-3 bound to the PRDIII-I regulatory element of the human…
1ZOQ 2.37 Å, IRF3-CBP complex
5JEK 2.4 Å, Phosphorylated MAVS in complex with IRF-3

Browse structure collections

About this viewer

MolViewer shows 3QU6 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.