1J4W: FUSE binding protein

Complex of the KH3 and KH4 domains of fbp with a single_stranded 29mer DNA oligonucleotide from the fuse element of the C-myc oncogene. Determined by solution NMR. Released 6 Mar 2002.

Method: Solution NMR
Organism: Homo sapiens
Chains: 2
Atoms: 1,413
Mol. weight: 27.52 kDa
Released: 6 Mar 2002

Explore 1J4W in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1J4W contains 9 α-helices and 6 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 9 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	3-10	8	1
α-helix	11-18	8
α-helix	20-22	3
α-helix	23-32	10
β-strand	35-39	5	1
β-strand	47-54	8	1
α-helix	56-73	18
β-strand	105-111	7	2
α-helix	115-119	5
α-helix	121-123	3
α-helix	124-133	10
β-strand	136-140	5	2
α-helix	141	1
β-strand	151-157	7	2
α-helix	160-173	14

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
DNA (5'-d(gptpatpaptptpcpcpcptpcpgpgpgaptptptptptptpaptptptptpgp*t)-3')	B	DNA	29
FUSE binding protein	A	protein	174	Homo sapiens	Q96AE4 (AlphaFold model)

Sequence of entity 1 (B), FASTA

>1J4W_1 DNA (5'-D(*GP*TP*A*TP*AP*TP*TP*CP*CP*CP*TP*CP*GP*GP*G*AP*TP*TP*TP*TP*TP*TP*AP*TP*TP*TP*TP*GP*T)-3') (chains B)
GTATATTCCCTCGGGATTTTTTATTTTGT

Sequence of entity 2 (A), FASTA

>1J4W_2 FUSE binding protein (chains A)
GSHMIDVPIPRFAVGIVIGRNGEMIKKIQNDAGVRIQFKPDDGTTPERIAQITGPPDRAQ
HAAEIITDLLRSVQAGNPGGPGPGGRGRGRGQGNWNMGPPGGLQEFNFIVPTGKTGLIIG
KGGETIKSISQQSGARIELQRNPPPNADPNMKLFTIRGTPQQIDYARQLIEEKI

Primary citation

Structure and dynamics of KH domains from FBP bound to single-stranded DNA. Braddock, D.T., Louis, J.M., Baber, J.L. et al. Nature (2002) 415:1051-1056. DOI 10.1038/4151051a · PubMed

Other PDB entries of the same protein (UniProt Q96AE4 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4LIJ 1.8 Å, Crystal structure of a far upstream element (FUSE) binding protein 1 (FUBP1) from Homo…
6Y24 1.86 Å, Crystal structure of fourth KH domain of FUBP1
6Y2D 1.9 Å, Crystal structure of the second KH domain of FUBP1
6Y2C 2.0 Å, Crystal structure of the third KH domain of FUBP1
2KXH Solution structure of the first two RRM domains of FIR in the complex with FBP Nbox…
8P25 Solution structure of a chimeric U2AF2 RRM2 / FUBP1 N-Box

Browse structure collections

About this viewer

MolViewer shows 1J4W directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.