1J5K: Heterogeneous nuclear ribonucleoprotein K

Complex of the KH3 domain of hnrnp K with a single_stranded 10MER DNA oligonucleotide. Determined by solution NMR. Released 10 Jul 2002.

Method: Solution NMR
Organism: Homo sapiens
Chains: 2
Atoms: 671
Mol. weight: 12.61 kDa
Released: 10 Jul 2002

Explore 1J5K in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1J5K contains 6 α-helices and 3 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 3 β-strands

Element	Residues	Length	Sheet
β-strand	13-21	9	1
α-helix	22-29	8
α-helix	31-33	3
α-helix	34-42	9
β-strand	46-49	4	1
α-helix	50	1
α-helix	52-53	2
β-strand	58-66	9	1
α-helix	67-84	18

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
5'-d(aptpapttpcpcpcptpc)-3'	B	DNA	10
Heterogeneous nuclear ribonucleoprotein K	A	protein	89	Homo sapiens	P61978 (AlphaFold model)

Sequence of entity 1 (B), FASTA

>1J5K_1 5'-D(*AP*TP*AP*T*TP*CP*CP*CP*TP*C)-3' (chains B)
ATATTCCCTC

Sequence of entity 2 (A), FASTA

>1J5K_2 Heterogeneous nuclear ribonucleoprotein K (chains A)
GSHMSYGDLGGPIITTQVTIPKDLAGSIIGKGGQRIKQIRHESGASIKIDEPLEGSEDRI
ITITGTQDQIQNAQYLLQNSVKQYSGKFF

Primary citation

Molecular basis of sequence-specific single-stranded DNA recognition by KH domains: solution structure of a complex between hnRNP K KH3 and single-stranded DNA. Braddock, D.T., Baber, J.L., Levens, D. et al. EMBO J (2002) 21:3476-3485. DOI 10.1093/emboj/cdf352 · PubMed

Other PDB entries of the same protein (UniProt P61978 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1ZZK 0.95 Å, Crystal Structure of the third KH domain of hnRNP K at 0.95A resolution
7RJO 1.38 Å, Crystal structure of human Bromodomain containing protein 4 (BRD4) in complex with hnRNPK
1ZZI 1.8 Å, Crystal Structure Analysis of the third KH domain of hnRNP K in complex with ssDNA
7RJK 1.85 Å, Crystal structure of human Bromodomain containing protein 3 (BRD3) in complex with hnRNPK
1ZZJ 2.3 Å, Structure of the third KH domain of hnRNP K in complex with 15-mer ssDNA
7CRU 2.8 Å, hnRNPK NLS in complex with Importin alpha 1 (KPNA2)
7CRE 3.0 Å, hnRNPK KH3 domain in complex with a ssDNA fragment from the SIRLOIN element
1KHM C-terminal kh domain of hnrnp K (KH3)

Browse structure collections

About this viewer

MolViewer shows 1J5K directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.