7CRU: HnRNPK NLS

hnRNPK NLS in complex with Importin alpha 1 (KPNA2). Determined by X-ray diffraction at 2.8 Å resolution. Released 17 Nov 2021.

Method: X-ray diffraction
Resolution: 2.8 Å
Organism: Homo sapiens
Chains: 4
Atoms: 6,959
Mol. weight: 105.18 kDa
Released: 17 Nov 2021

Explore 7CRU in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7CRU contains 68 α-helices and 0 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A and C: 33 helices, 0 β-strands

Element	Residues	Length
α-helix	78-86	9
α-helix	90-106	17
α-helix	112-117	6
α-helix	121-127	7
α-helix	134-147	14
α-helix	152-160	9
α-helix	163-170	8
α-helix	176-191	16
α-helix	194-202	9
α-helix	206-211	6
α-helix	218-220	3
α-helix	223-236	14
α-helix	243-245	3
α-helix	246-259	14
α-helix	265-279	15
α-helix	283-291	9
α-helix	295-301	7
α-helix	307-320	14
α-helix	325-333	9
α-helix	336-338	3
α-helix	340-344	5
α-helix	349-362	14
α-helix	367-375	9
α-helix	379-388	10
α-helix	391-407	17
α-helix	410-418	9
α-helix	422-427	6
α-helix	428-430	3
α-helix	434-454	21
α-helix	457-466	10
α-helix	470-474	5
α-helix	475-478	4
α-helix	482-495	14

Chains B and D: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	30-32	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Heterogeneous nuclear ribonucleoprotein K	B, D	protein	23	Homo sapiens	P61978 (AlphaFold model)
Importin subunit alpha-1	A, C	protein	457	Homo sapiens	P52292 (AlphaFold model)

Sequence of entity 1 (B, D), FASTA

>7CRU_1 Heterogeneous nuclear ribonucleoprotein K (chains B, D)
WMEFGKRPAEDMEEEQAFKRSRN

Sequence of entity 2 (A, C), FASTA

>7CRU_2 Importin subunit alpha-1 (chains A, C)
TVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRTD
CSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGD
GSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQI
LPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTP
ALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQ
VVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAK
DTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESVYKASLSLI
EKYFSVEEEEDQNVVPETTSEGYTFQVQDGAPGTFNF

Primary citation

Nuclear import receptors and hnRNPK mediates nuclear import and stress granule localization of SIRLOIN. Yao, J., Tu, Y., Shen, C. et al. Cell Mol Life Sci (2021) 78:7617-7633. DOI 10.1007/s00018-021-03992-7 · PubMed

Other PDB entries of the same protein (UniProt P61978 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1ZZK 0.95 Å, Crystal Structure of the third KH domain of hnRNP K at 0.95A resolution
7RJO 1.38 Å, Crystal structure of human Bromodomain containing protein 4 (BRD4) in complex with hnRNPK
1ZZI 1.8 Å, Crystal Structure Analysis of the third KH domain of hnRNP K in complex with ssDNA
7RJK 1.85 Å, Crystal structure of human Bromodomain containing protein 3 (BRD3) in complex with hnRNPK
1ZZJ 2.3 Å, Structure of the third KH domain of hnRNP K in complex with 15-mer ssDNA
7CRE 3.0 Å, hnRNPK KH3 domain in complex with a ssDNA fragment from the SIRLOIN element
1J5K Complex of the KH3 domain of hnrnp K with a single_stranded 10MER DNA oligonucleotide
1KHM C-terminal kh domain of hnrnp K (KH3)

Browse structure collections

About this viewer

MolViewer shows 7CRU directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.