1ZZJ: Third KH domain of hnRNP K

Structure of the third KH domain of hnRNP K in complex with 15-mer ssDNA. Determined by X-ray diffraction at 2.3 Å resolution. Released 9 Aug 2005.

Method: X-ray diffraction
Resolution: 2.3 Å
Organism: Homo sapiens
Chains: 4
Atoms: 1,855
Mol. weight: 31.14 kDa
Released: 9 Aug 2005

Explore 1ZZJ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1ZZJ contains 17 α-helices and 9 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 3 β-strands

Element	Residues	Length	Sheet
β-strand	14-21	8	1
α-helix	22-24	3
α-helix	25-29	5
α-helix	31-33	3
α-helix	34-43	10
β-strand	46-49	4	1
β-strand	58-65	8	1
α-helix	67-82	16

Chains B and C: 6 helices, 3 β-strands

Element	Residues	Length	Sheet
β-strand	14-21	8	2
α-helix	22-24	3
α-helix	25-29	5
α-helix	31-33	3
α-helix	34-43	10
β-strand	46-49	4	2
α-helix	50-53	4
β-strand	58-65	8	2
α-helix	67-80	14

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
5'-d(tptpcpcpcpcptpcpcpcpcpaptptp*t)-3'	D	DNA	15
Heterogeneous nuclear ribonucleoprotein K	A, B, C	protein	82	Homo sapiens	P61978 (AlphaFold model)

Sequence of entity 1 (D), FASTA

>1ZZJ_1 5'-D(*TP*TP*CP*CP*CP*CP*TP*CP*CP*CP*CP*AP*TP*TP*T)-3' (chains D)
TTCCCCTCCCCATTT

Sequence of entity 2 (A, B, C), FASTA

>1ZZJ_2 Heterogeneous nuclear ribonucleoprotein K (chains A, B, C)
GAMGPIITTQVTIPKDLAGSIIGKGGQRIKQIRHESGASIKIDEPLEGSEDRIITITGTQ
DQIQNAQYLLQNSVKQYSGKFF

Primary citation

X-Ray Crystallographic and NMR Studies of the Third KH Domain of hnRNP K in Complex with Single-Stranded Nucleic Acids. Backe, P.H., Messias, A.C., Ravelli, R.B. et al. Structure (2005) 13:1055-1067. DOI 10.1016/j.str.2005.04.008 · PubMed

Other PDB entries of the same protein (UniProt P61978 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1ZZK 0.95 Å, Crystal Structure of the third KH domain of hnRNP K at 0.95A resolution
7RJO 1.38 Å, Crystal structure of human Bromodomain containing protein 4 (BRD4) in complex with hnRNPK
1ZZI 1.8 Å, Crystal Structure Analysis of the third KH domain of hnRNP K in complex with ssDNA
7RJK 1.85 Å, Crystal structure of human Bromodomain containing protein 3 (BRD3) in complex with hnRNPK
7CRU 2.8 Å, hnRNPK NLS in complex with Importin alpha 1 (KPNA2)
7CRE 3.0 Å, hnRNPK KH3 domain in complex with a ssDNA fragment from the SIRLOIN element
1J5K Complex of the KH3 domain of hnrnp K with a single_stranded 10MER DNA oligonucleotide
1KHM C-terminal kh domain of hnrnp K (KH3)

Browse structure collections

About this viewer

MolViewer shows 1ZZJ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.