1JQY: Heat-labile enterotoxin B chain
Heat-labile enterotoxin B-pentamer with ligand bmsc-0010. Determined by X-ray diffraction at 2.14 Å resolution. Released 8 May 2002.
- Method
- X-ray diffraction
- Resolution
- 2.14 Å
- Organism
- Escherichia coli
- Chains
- 15
- Atoms
- 13,904
- Mol. weight
- 183.71 kDa
- Ligands
- A32
- Released
- 8 May 2002
Explore 1JQY in 3D
Show helices and sheets
RCSB PDB
PDBe
Secondary structure: helices and β-sheets
1JQY contains 65 α-helices and 94 β-strands across 15 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
Chain D: 4 helices, 6 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 5-10 | 6 | |
| β-strand | 15-22 | 8 | 1 |
| β-strand | 26-32 | 7 | 1 |
| β-strand | 35-41 | 7 | 1 |
| β-strand | 47-50 | 4 | 1 |
| α-helix | 51-53 | 3 | |
| α-helix | 61-77 | 17 | |
| α-helix | 80-81 | 2 | |
| β-strand | 82-88 | 7 | 1 |
| β-strand | 94-102 | 9 | 1 |
Chain E: 4 helices, 6 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 5-9 | 5 | |
| β-strand | 15-22 | 8 | 1 |
| β-strand | 26-30 | 5 | 1 |
| β-strand | 37-41 | 5 | 1 |
| β-strand | 47-50 | 4 | 1 |
| α-helix | 51-53 | 3 | |
| α-helix | 59-78 | 20 | |
| α-helix | 80-81 | 2 | |
| β-strand | 82-88 | 7 | 1 |
| β-strand | 94-102 | 9 | 1 |
Chain F: 4 helices, 6 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 5-10 | 6 | |
| β-strand | 15-22 | 8 | 1 |
| β-strand | 26-30 | 5 | 1 |
| β-strand | 37-41 | 5 | 1 |
| β-strand | 47-50 | 4 | 1 |
| α-helix | 51-53 | 3 | |
| α-helix | 60-77 | 18 | |
| α-helix | 80-81 | 2 | |
| β-strand | 82-88 | 7 | 1 |
| β-strand | 94-102 | 9 | 1 |
Chain G: 4 helices, 6 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 5-9 | 5 | |
| β-strand | 15-22 | 8 | 1 |
| β-strand | 26-30 | 5 | 1 |
| β-strand | 37-41 | 5 | 1 |
| β-strand | 47-50 | 4 | 1 |
| α-helix | 51-53 | 3 | |
| α-helix | 59-77 | 19 | |
| α-helix | 80-81 | 2 | |
| β-strand | 82-88 | 7 | 1 |
| β-strand | 94-102 | 9 | 1 |
Chain H: 4 helices, 6 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 5-9 | 5 | |
| β-strand | 15-22 | 8 | 1 |
| β-strand | 26-32 | 7 | 1 |
| β-strand | 35-41 | 7 | 1 |
| β-strand | 47-50 | 4 | 1 |
| α-helix | 51-53 | 3 | |
| α-helix | 59-78 | 20 | |
| α-helix | 80-81 | 2 | |
| β-strand | 82-88 | 7 | 1 |
| β-strand | 94-102 | 9 | 1 |
Chain L: 4 helices, 6 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 5-9 | 5 | |
| β-strand | 15-22 | 8 | 2 |
| β-strand | 26-30 | 5 | 2 |
| β-strand | 38-41 | 4 | 2 |
| β-strand | 47-50 | 4 | 2 |
| α-helix | 51-53 | 3 | |
| α-helix | 61-78 | 18 | |
| α-helix | 80-81 | 2 | |
| β-strand | 82-88 | 7 | 2 |
| β-strand | 94-102 | 9 | 2 |
Chain M: 4 helices, 6 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 5-10 | 6 | |
| β-strand | 15-23 | 9 | 2 |
| β-strand | 26-32 | 7 | 2 |
| β-strand | 35-41 | 7 | 2 |
| β-strand | 47-50 | 4 | 2 |
| α-helix | 51-53 | 3 | |
| α-helix | 61-77 | 17 | |
| α-helix | 80 | 1 | |
| β-strand | 81-88 | 8 | 2 |
| β-strand | 94-102 | 9 | 2 |
Chain N: 4 helices, 6 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 5-10 | 6 | |
| β-strand | 15-22 | 8 | 2 |
| β-strand | 26-32 | 7 | 2 |
| β-strand | 35-41 | 7 | 2 |
| β-strand | 47-50 | 4 | 2 |
| α-helix | 51-53 | 3 | |
| α-helix | 59-78 | 20 | |
| α-helix | 80-81 | 2 | |
| β-strand | 82-88 | 7 | 2 |
| β-strand | 94-102 | 9 | 2 |
7 more chain groups are not listed. Open the entry in the viewer and use the sequence panel to see them.
Molecules and chains
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|
| Heat-labile enterotoxin B chain | D, E, F, G, H, L, M, N, O, P, V, W, X, Y, Z | protein | 103 | Escherichia coli | P32890 (AlphaFold model) |
Sequence of entity 1 (D, E, F, G, H, L, M, N, O, P, V, W, X, Y, Z), FASTA
>1JQY_1 HEAT-LABILE ENTEROTOXIN B CHAIN (chains D, E, F, G, H, L, M, N, O, P, V, W, X, Y, Z)
APQTITELCSEYRNTQIYTINDKILSYTESMAGKREMVIITFKSGETFQVEVPGSQHIDS
QKKAIERMKDTLRITYLTETKIDKLCVWNNKTPNSIAAISMKN
Ligands and cofactors
| ID | Name | Formula | Copies |
|---|
| A32 | (3-nitro-5-(3-morpholin-4-yl-propylaminocarbonyl)phenyl)-galactopyranoside | C20 H29 N3 O10 | 14 |
Primary citation
Anchor-based design of improved cholera toxin and E. coli heat-labile enterotoxin receptor binding antagonists that display multiple binding modes. Pickens, J.C., Merritt, E.A., Ahn, M. et al. Chem Biol (2002) 9:215-224. DOI 10.1016/S1074-5521(02)00097-2 · PubMed
Other PDB entries of the same protein (UniProt P32890 (AlphaFold model), which also has an AlphaFold model), best resolution first:
- 1DJR 1.3 Å, Heat-labile enterotoxin B-pentamer complexed with M-carboxyphenyl-alpha-D-galactose
- 6IAL 1.45 Å, Porcine E.coli heat-labile enterotoxin B-pentamer in complex with Lacto-N-neohexaose
- 1EFI 1.6 Å, Heat-labile enterotoxin B-pentamer complexed with para-aminophenyl-alpha-D-galactopyranos…
- 5LZI 1.6 Å, Porcine heat-labile enterotoxin R13H in complex with inhibitor MM146
- 1LT5 1.7 Å, Heat-labile enterotoxin B-pentamer complexed with thiodigalactoside
- 1EEF 1.8 Å, Heat-labile enterotoxin B-pentamer complexed with bound ligand pepg
- 1FD7 1.8 Å, Heat-labile enterotoxin B-pentamer with bound ligand BMSC001
- 2XRS 1.81 Å, Crystal structures exploring the origins of the broader specificity of escherichia coli…
- 1LTS 1.95 Å, Refined structure of E. Coli heat labile enterotoxin, a close relative of cholera toxin
- 1PZI 1.99 Å, Heat-Labile Enterotoxin B-Pentamer Complexed With Nitrophenyl Galactoside 2a
- 1LT3 2.0 Å, Heat-labile enterotoxin double mutant N40C/G166C
- 1LT4 2.0 Å, Heat-labile enterotoxin mutant S63K
Browse structure collections
About this viewer
MolViewer shows 1JQY directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.